ELF+@U@8@$(`%`    !"#&'(),-.013456789:;<=@BDEFGHIKLMOPSVXY[\^adfgijklmoqruwxyz{}~   "#%'()*,0124679;<=?@ABCEFGHIKLNOPTUWXZ\]^_bcdefhjlmnrvxy|}~    !#$'()+./01567;=>?BDEFGHJLNQRUXYZ[^_`bdefjnpquvwxz{}    !#&'(+,-.0145789:;=?ABCDEFGHJKNQSUVXY\]^_aeilnopqvwyz{}~     "&'(*+.1234579;<=>?@ACDFHIKMNOPQSUWYZ]^_abcdeghjklmnopqrstuxyz{}~    !"#%&')*,./0246789:;=>?ABDEFHIJLMOPRSTUVX[]^_abcdfghjnprtuxyz{}~   !#%&(*,-/134568;=?@ADEFGHIJKLMOPRTUWXYZ[^`abcdfhilnopqrvxyz{|}     "#$%&')*,./13478:;<=>?@BFHIJKNPQRSUVY[\^_`bcdeghimnopqrstuvxz{}   !"$%&)*,-/023457:<@ABCDFGHIKMNQRUVX]^_`aceghjlopqstuwxyz{|}~                " # $ & ( ) * , - . / 2 4 6 7 8 : ; < = > ? @ C D H J K L N P Q S U W Y Z ] ` a b g h k l n o p q s t v x z { ~                   " # $ ' ( ) * + , . 0 1 3 5 6 7 8 9 : ; < > B D F G H I K L M N Q S U W Y [ \ ] _ ` a d e f g h i j k l m o p q r s t u x z { | } ~                    ! " # $ ' ( ) , - . 0 1 4 7 8 : ; < > @ A B C D E F G H J L M N O Q T U V W X Z [ \ ] ^ _ ` b c e h i j k l m p q s t u w z { | } ~                    ! # $ % ( ) , - / 0 2 3 4 5 6 7 : < > ? @ A B C D E F G H I J K M O Q U V W Y Z \ ] ^ ` a b c g h k l m n p s t w y { | }         $%*+/2>?ACJNQRTUWZ]_`bcehnpstv|   !$&+-./358:>DJMQRSVY[`agikopqstuwz{  "%&*,-23489:<@ACIKMOPSTVW\]acghiklmorsty|~  "$%)*/236<>@ILMOPRTWZ[`bcdfghjkmrstux| !#$%),-/068:BEGJLRTVX[\`fivw|  $(+-135<@CGKNQWYZ\`eiklmoqsvw|   "$')+.0279:<>BCNQSV\]_egjkmstuw~ !(+-02569ACDEGLMOTWXZ]afjklwy|~   #'(+.1689;=>?EJLOPSTWYZ[\bdfikmnrv            ! % ' + 0 1 3 5 9 A B E F G I M O R T V X [ \ ^ _ c d e f i j m r u w y | }          ! % & - / 2 4 = ? @ A C E J O P R T V X Z ^ b c n v w y         % & * + / 2 3 5 6 9 = ? I K P R S Y a d f g n o r v x y         " & ' * + . 1 8 9 ; = L N P R S T X [ _ d e f i j o q r u v x z ~          DH  %1 pL Zb Gs C t <0 Yx >%}XH d  & b$= N p_ 8Tk Pv  Yp \hC8 x D \` t" t4 ߈= YtJ  |e b4| H c0 ;88 4CYt P H < T  |$ H: qdDL -l] >n  h Xp% &,D XxCh dL8C`B B,TOW%h l<  F,% \ :\ Dx   d"* 6@ I  S tdi 4} n4 %  t a@  p l4  X! }T5 0@ rT pa%hp } 9PL   Od Mt4  &0 м " Ȉ? ͠XJ Ìm Kx% XC  X p .8 \  + Ch7 pK @,Z tk ?Hly  X $l    4$ +D%0  L %y %%0 5 lt Q \ Z 4 i z M     8     vl  SX  Y,  V  :  t 8 `H K  V iT `  l F { 3h  .`  x(  H  n4  @  '  D      * < 6  ?  M l Z `8l j \ s !X    xt   K(  G$4  ͘  t  d  Dl , 1 d( C P Z |x$ j  r    $ %    (P    (  H    % | ;  C ( X  d P t ,  .   H  h  X  $  (   L, OLL ] t x .P &L 8 | yH i@ , 8 ~ w8  ,( r(9 PY r #Dd -  p 0% l WP" 4t* <LBG _ |t  L ;  LL @%P b @ X Hls%4 B,A R 4,k ܐsz Q H < IP%z Ŕ H h p 0,! \- T<? G 844^ b$g  g0D g%` %`  R  h  \,F ,$Z 8m hz `   \ XL T x\h [$0 h$@ + DT=%ͰN ]dL\ i  H H XD\p  lD   d D\ ^  h& 5 A%@\ h p%     %% tl (  $t<) ,`9 Gp @%0Q 4$` Hl }dP P <0 D  blL%c  > kD%x1 0@9%H p`\%Poy ` d XP%0 D\ $ 8H |$ {  ( /d) <: yPY !h TD<} ( X` 7 , H%p  0 4  H! XT4 A ?|L  T {t^ X t A%%yp  X t  ,    4  UX%@' H(@ LT cf N(y yd g TT  "(  8, %  5 \ LE%X a Y4v , JT PP  Y$  /P\  4 P<& T? JhO jl[  t gt *p  % h XP  ) `t" D 8 =X@ <U e (x  ep, /   l  s4 zX%X$ 9 .E `PZ d%ym `  H ר lH p /0 X " d`+ H: gM T\ $g 5x%z Cp 8t@ @d "X$ p| L 4((  %X % 2 > d\ J%yL R Z 4< r |( CX  e     hL  t  H   !X! l\L!, L!@ X!U !g%!u 8! ! P! z! |! T! t!  P!%{0" ޸," [l" hT"' (l"= L"V "d i "r%ʐ"" XP" `"%"%@"" D" d# %# PT#4 (#M #W% #g a# ## @`# 1p# +`# <# d$ "$  $, $@ <$S $$i |H$w $ wP$ D$ 6H$ $ p$ s(% H8% T%)%1 g%K %Y u<%l <" J% ^X% H% 'P% % % 8%%z@& 4&  |& H&- X&DC&[ tP&i  &p T& ]L& &%̐& t& $& P& d& 8' j4' iT'# ;p8'1 <'D b'[ 'hD\t't%} ' TT' x'%ʘ' ,' $'C´' d'( ( P(3 ]4h(> "(U (r \( ( 8( 0( H( ( $( ) 7) )0%()>)G )_ )s  TX) P) Pp)%y) ) Ph 8) l0) `) ݌,*  s@*%h*, d*< b(*S *Z "|d*j (<*w \* L8* d* * d* u* }0*% * U$$+ Mx+ (+, K`(+FC+U p@+h +t *,+ d+ X+ H+ '+C + :,, L, 4H,# E|,1 W,H ,\ $,l D,| $, H,,%, , , ``L,Cx, @, 4- - -" `(-= ~-K d|-X -j eh-v - ^-  - P- L0- ~- W@- N`4-L. $.# H0.0.5 *.M ,.\ H.p |.%}. <L. ,8.  <. 8. S,. <. L0/ %X/ P/0 \/B `/N \8/] /k H/ T0/ p/ R8X/ q/%/ ,/ d/ / J|0 %0 $L0' 406 80E 0f P0 @pP0 H0 %0 (0 7,0%h0 ,`@1  1 n`1(%̈15 P1A ,1` J 1} 1 (111 ^P1 qL01 @1 1 2  2% d25 Dh2ACY|2F L2Z 2f 2v 2 x2 2 2%2%˘2 "(3  El3 363B Ō3P3X 3e 3q 3~3 03 &`333 L3 33 4%y4 (4 p<4) 41 d4C  0 4W `4p <4 a(4  4%4 @4  4 ;4 84 T5%5+ |5M 5\ 5u%b5 5 5 \5 {5 D5 Dx5 5 06C¸6%6 4<60 !6A XX6Y `6i ȸ@6x ׀6 a,6 a6%6 (X6 d6 t6 |,6 h7%H7- "7? 847^ l7s 7 !7 s7 *d7C7 t7 nT7 Xl8  X8 8* 8= &8K8S @8\ 8s dd8 )H<8 (@08 |8 '(8 48 ,9 d9 ݌d9. <9= 9\ 0 k9j D`9r | 49 |P9%9 9 |`99 |,9 9%ͨ: (:  : p:, :5 x,:C 84:T :_ :y L: b0: p,: I(x: 3L:%( : : B |: :T; d; ;) ;5 {( ;C ;K ;V Z;b 8;o n8,;{%; @; OLx; `; @; L; ,; u(; D`0<  0# <#<) 8<4 KL X> >0 :`>D bp>] X>k >v./>| + > > p> g$> ,\> d> L`? ?  <4? /?0 Р?C D ?U?[ !?m  ?   @|? (,? g4? h? ? ? V\? -4@@"%H  È0@5@? )@U 1 @a @k &@ %L@ ٨@ l@ P@ ,@ 2@@@ d@ A %{A 'pA- 5A> 3AK A^AhC¨A l A ӠA A +dA l< A BA%A ,B pB qpB"C°B/ 9`,BI xhB] Bf ,xBq TtB hB B ,B `B h<B OB lB hLC  C C+ @8C3 GCB C\ `Cg G(CrCz%zC p|C *|C HC 0C $,C pC C LD  z(D D5 D@ HDL%0DZ rdDd Dr %AD DD 1D%hD cD ʤD%˨DE wE c`8E< @EJ dEn |Ez H hE lE ]E E $lTE DE EE nL4E F  F+ F=%pFL XFc @Fn F}%zF yF F +\F%{F F L0hF `F @dF ,<G  NLG' ] G= GRGZC€ Gq rl4G{ lG G \0G%8G (G lG%HH dH 8hhH:%zHI  uH\ @Hj ˬ$Hr H H HH ĸH |H <H lH hdH  I ,`I$ I1 p`IE IZ ,Iu I~ JhI PI I ǨI  LI DI lI I tJJ%J& J8 |JK pJi Js tJ LJ L(J PJ LJ NJ ǐJ ITK P0K  hPK @K,%K:%zKG dKU `Kj%Kz K K  K |K AhK ,K xdK%0L tL L$ DL;%͸LN%hLd LLt THL L%L%L%LL "L L M%zM' $M?MJ MgMmMt 0M <MM E(M pMCp M H,MM ``N XN PN$ (N0  XNJ%bN[ ,TNt xN PN zXNCpN \N 5N [h քPN%ˠN "|$N%O  pO* mTOD POS hDO` @Op xlO O >lO HO HO \O P P  P) 9 0P@%PT `Pc PP} P nHP%ʰP (P K(8P Q $\Q%͐Q%Q. D0HQG  TQ_%Qx L pQQ Q Q LQ RQ oX Q%Q lxR  XLR%R- 3xR9%RF 8R[ Rr PR p0R ,R 0(R OxR R DR `S DS  6pLS' S? SM ,lS[ oP4Sd lXSt%S (S >t <S m@S DxHS S%hS 0<S <T fdT  T 0T6 xT> '@ TU T] TTg (TCTT ,T TT T T U s(U%U  @U/ ,U= ~\UF ,`US UZ Uq%zU PU U 38U% U U U U dU V V$ 9L-VD V[ f(HVl pVy hV 8V $V |VV%V%̠V :,V V dW QLW W# xLW> $WZ L3H) |Wk @W dW W 8W W W HW W X% %zX X5 lX? LXP <0X` 4Xl @Xw HX xV{X X CX|X d(X `0X K@X P\YY pY, |YE YV $Yg%cYq _Y (Y |Y .Y ~0Y PLY =|Z dZ p(Z,  XZC%xZS Z\ Zn (Z| dZ TDZ `,DZ 0Z Z Z JZZ dZ \h[ [$[4 [G @|[T 8<X[r ,[ |4?P H[ ¤p[ [ [%X[ H[ F$[ P\ \%\+ ( \; p\I H\b d\o @\ aL\ \\ \ ^HL\ '\ \\ w@]  4]# !@]0 X(]E }]R ]f%̀]r \] ]  ] |]] hh] l4]] ] |8] \^ ^"%yP ^2 8^? ^R |^Z (^m%H^| YP@^  ^ <^ w^%y ^ ^ O\,^ @<_ _ N(_8 _E _Z_b _z $__ )_ (_ l__ ` `"%`1  t`N `a S@`q`~ @` ` X` ` ` L` a  Wa&a- ,aEaM ) <a^ |ar l a~ a 2 a ְHaC@a%0  UT$a vda%` a 4a \8a lb b ,b- Xl,<%<a 0LbF bU ibc bq b} H<b <b hbb b 3(b fxb  c 'c 9Pc( jPc: cF  c\cc 4cu Zc Xc c *c L|Lc J8 c 8c Ld d C `d d+  Dd7 dH dT Ҁd_ (pdx )pd mHhd r(0d hdd $d $d  e e <e7 {4eD GXpeW (4ef Hev%Hee 0e \e BhLe e `@e \Xt= de @e hf  df <f- Qf> xfJ E|fW Lf` # Xf  Lf f f 0f%xxf f%̰2 g  3g ~g& `,g? `dg_%xgv q|,gg g g g |g V\g ph  Lh"h(%h? XhQ h8h\ Thk X hs |@hh l8hh Ph kh  hh !0i ,i sL,i. i@ liR ib S(@it v @\i] PPi Pi%wii i i  j  jj  4j0 @jG Hjc tj j mTj lj 4j Őj ,@k d(k  X(k8 ",kI Ak] P-\ fkn%8k k%zk%yk |k 4(kk Ek LkY  Shk @l $l dl' 4P(l8 plL lX alk 7l l @pl Dl N,l !  l ?l%{pl pDlm -@m Ҡm m( tm7 %,mB 0PmN (\mY mcmz m  m Bm hdxm ,m mm <m H(n% hPn5n< &4@nX%͈nd Ӱnm ln| ln hn%n 4n Tn mDn n 5@To  !$o Xo) A@o> ,oN od (op 0`  Gxox   M0o Lo  oo 8o ^o ]o ,4oo Pp p XPp' p5 $pS <pa%pn p~p p%p 3Hp |p %@p Pp [tLp ִq%ʨq$ Tq0 `Lq> dp'^ xXqE%qZ%z0q^ qjCPq~%p>uq q tq% q A4q ]L t: Lq Lq r  dr  r(r= Wm hrM |drZ (rq ,4r~ r GLr Tr r @r `hr%Xr W@,s 4s s'%{ts8 ,sX d8sf aTs{  8c  s s PsCXs (D s -Ps Hs Ps Hs ht %t  "PtF XtUCltdtz tt 8t%t D `t t `t t u  7Lu'u1uE @uO q(uZ D8(ur Hu $u%u ,u Lu ׌u uChP]v  Ov v/ cPi $vH ,vO 4(vg Y\v%v B<,v {v (v Xv v HXv dw 9(w \dw( |Hw;D\wJ D,wh ws NLw Hw ,`w ,$w $w% w `w Fh4%H <x Fx 4Lx( <Hx: <lxN%yxZ @xp <px tdxx <44 <xx ,(x%x y  Py* 0<y5Cxy= yK ,yf b(yw kl`y ,y%zHy y c@y (y kz 8 z  oXz 3(z' 4\z1 Yz= ,zP (0za lzh%zy #dHz 8zz z%sU iz Wz%yU  `z dz LHz {  oh{ O4{% H{? z{Q{a +(8{u (p{ $,{ 4,kP ! { { {dM{ { *|||  | 9P|E%|\ ]L|n%y|y%̸| Ix||%̨| $| `| 8| lL| 88}  \} }+ }7}? ؀8}E L,}U}[ 1}s xL} q(}%(} 8}%} }  ,}CY~ Dx~ ~* ~ 0~> (~M ,~[ |; lX~s~{~ ;~D\x~ ~%~ ~ T~ D~ a< ") ߔ: G $Z Tj Tx 4T h0@ 5 ~l 8@2 g H %˸   L* 6(T<%O <b H<L{ "4$M\  < H T  |t H, 58, T ЈP'%b2 ߀BI Xc )}%z  Z8 0, d|  8a! t,  od`   4  /%? tQ <] K(z lP    l T4    D p . A\H=%HR ~P4f  z ,(  k DH P +  H X9%z8E HV _|Lg d bLCL 8P {  h x  S ", (H7 %(> dI HU `p \d j ap4%P ȘP <  '< T8 l  $ <`'-%(> (XlS `f ,w ,g kP |$%{` <d  {0BC h d4 l, V  l1 K o@@U%ˀf 5(~ %  ? H ,* T |%P ې ( '%?%0UD\lc  \s n4| | w| | T  ̰%x 8 % xp; (I ,U  Pm v o  $h 4%0% fh% K@%y% 8 -lF (YCYxc x4$o %   <P <  h` n FH Dp$ ; LM%`ci x  l d (X P {$ \ @D\ #x %" 8l+ 07 HL 5g~ }R ` $| & \  t 9  L  %`  H4%D U e `0u  X $ 0X   H ~ L  7$0 B O 0\ h t}  qD P 4, ,  T4 <4 L  xP wL2 ߜ; [xM%ʠcl ؈<w ( t 9 $h   !PX  T/ Oh9 %<I ? Xlb m% ( Xp !( C| d X| b I(4 lA $Q f @p b4 ?$ b D`% L , 4 T& X2  (A pxX <g L !(( j`L Qh  %(( ݈  d!* X D \N Xe v XP  A%  Tt   ( %x @&  : pJ W d 8vCh H\  f  @  |, (   b5: PP ״_ Xs ;  ( ad %   ) ilP \ tB +H6 *d? TN bT`%r <   XP, <} 4 PC` ]H\ l j' \TD= pxl p^ 8TD0 n ~ " L d %̘  8 \t  %y $ T5 pC a(d! HM "(ljt `  D X XdJ 4 `< 9<z ؔ T L aX  l Dd+%6 .hD a 1D~ b\ l |  a$ D r0|  ( 64 ' (hW 7 4(-A (O |C׀b \to ˬH P (  H@  ( T %p c8 ' p7 IQ 8d u p _0L H ;t VHX (%b H(  9 <( |4 P@ TK ` %Hm ,t  d,%ʈ t B0 h D,  *P" ,7 N kCtC` -|  \ L  ]P np T L4 2 PdI p^ 8\ Xm 5x|  D # h% <l , 7   T. C +0_ pk y 0LH%  X% 8  h h H @D0%z;%yC U` (dt Lh  U@   < Q    &|\ -) D; TT tPa ј0j v a \ 6 H  B4 w| CO TxT7  Ml* D$F HxO ( hn Hx 0@%D\  b< XX  < G, vlS Kr   XX  \ Ml  ,h T& 9%K lQ b 4Hn H$z ( @%  ( ld T  ̔t$ Rp,1 @ C%{S%ˈdj y% hd < *0d R : 0  bLS O P C<& l8 5d,Q \l Tu ;Dd  ~A %z  |T$ r   vp  sx, 4|' 4 bB @U%pg x vp ((Eg %8 pH (U  %29 0 X  r0 <,CH" 8* Ax8 hB xPN `\ q Do  Ix  %1 N  Z  h ߴ   t: XD PHR ,_ k d~   9%H 4H d pH P * p L% 8 p`XD zPQ Te L] q g,~ 3X gl d < Pt p @  nH -4 |BP FxP> P d^i v lP@ cp (t y%@%x= S T, %-%`Y  B @D  lQ (d%h Xx~ %jx@%z H  R9 <\ 0t ]4 u)0 < T@pE M Tg < p<f%˰w fD f L< e TD\h l4 84%[ |( P X*  D%zO _L`CPf y @!  D%@ 8 A /  (    $: [(D MhO \d%x P p%  d  ̈́ 9 t! 03 b LPY lD c2 M%{x] Fl%͘{ 8`$ T% 8 %{| 8 Q   %zx#* e,$@ ^LO 4^ hg y „ ( h }<   A y M0 3  L& X1 ;=%y` M Z%ʀw   ׼   %%{j P  % 44 F xe ӄT |$_ alLj ({ @%jp ] xH%z 9< CL  \  D\7 P ʐ *  5 DD> L B\ p8h cdw ɤ  dp D 0 < p   0D ,' 8 6\X dl M,|  ! : % CX p(  i  Մ  %,%.%ʸH%[ mt  1t%b lh @< < `L \, lL eD, 0) 8 1,E |0U  Lem PE @z [L jL, e, xH%͠ A nd$ (  pDD 4, `: MHChX t$a y l , b h \$ x א "4    \L/ @ $V pj 4 zlt h phX *d#    ` F, H #@$6 KC%W  ; tPh 8x   FH(  uL %h F, x  %x P$ , Jh8 (Q ] hy  < |0%P` ڰ Ԉ   ( |`C | \(" a- X:%pG NdY rX0h @\s~ t   , L C &  q0, 7 X,aL >H] {w 0 | w0 a4<   l | D ` ] W#%ː9 2S] \p%(  :`t%{h  P< h8   Dx 'T! - @ thH 4_ THt| 4<t (C  Č % H,%z  ]$$  pP1G 64W%f Pdx "d@ -x ( | 'e} ,  D$ F%  YxT 47 B M h\ )v   d t  1   `< Pt  ߠ pt+%8A 40P hZ ,ry 7$†%|• uD¨  p¶ jP P $D 8 D  P) x(1CPC U <E r@,h $x q tÆ Ú%ô 4<%z~"  <  4 \ ) ,%%< ьE ) S Hr (ą JĚ ĭ kL4Ľ%yH T   x$ d6 B <K e &hu qDń Y\ř ҠŰ |žCYp2_ v@ ( X%8 H %1 (lC PS H,b t\o  { (Ɩ ƞ%xƮ L  (  D  $ V@: @F TY Ta @w 0,nj fpHǠ%dz  d Ԉ $  l tCD# H5 WG [ !h  s Ȅ xȟ hHFȱ $ tP , ` pH 1d/ fD@ hK kh8T ٤ 0, ] (m  y ˬpɚ ɤ 9`ɲ  L 4xL ( %@ 4L <X P p}%ʌ y ʡ 0ʯ L 8x%̀n%y  @ '(    0|= Pp_ p , $˜ˤ h˰ H \( EP` v%d` $ 4  x0 E [ 8xk%z tṪ ~d8̚ sd`̨ ̺CH $ i  , ( W7 E DT hf Xoh ́ ͚ {ͮ ͺ p ?l  p  \- > TI S  u ΀ @Ή%{XΔ Χ Cβ  κ @  y, 8   |  X% >  HP #^ x{  ϐ GXϞ 4hϫ eHT 78Ϸ   :  Cl| o4 H2 ch? S`HP (\ 9`pl Yd xh 0Љ pН $d@ЧC8в  |   d <@<  ( D. ? H@LT lk hz Hф dє џ |xѳ d, P d  eT ) 7%x@%V a p b҃ (tҚ%{ҥ ұ b 8 T dX Ҭ@ H_nsr_closensrrm_set_handlestat_cmp_stdev_funcNETUTDM_dm_sync_handlelistnwora_create_res_filensr_parse_amountclntpbcs_restore_1_Delayed_flushesattrlist_buildvprinterrdo_volume_operationlg_ts_ctimeget_app_meta__xdrclntnsrfx_delete_ss_6_6fdtable_xprt_registerset_indexpath_serveruca_allocsbtpc_object_sbtpcquerybackupclntnsrfx_info_5xdr_int32_tseceastgmtclient_list_add_clientlg_fstatvfsca_inithand_user_RO_numberStart_varp_listxdr_PBCS_DISCOVER_argsbuild_lgtoauth_parmsset_client_cache_update_style__lgto_xdr_svcinfoclntmm_retrieve_5lg_ctimefetchss_timeNETUTDM_dm_getall_sessionsxdr_nwbsa_objectname_snsr_findserverxdr_nwbsa_objectname_txdr_ssids_tregex_cmpVflagidlistprintmemcmpxdr_NSRFX_SET_6_argsget_bsaattrdxuldm_initrecoverstateNETUTDM_dm_handle_to_igenxdr_PBCS_RESTORE_argsxdrrec_get_handlelg_get_securedirconsume_filedataclntmmdb_enumss_name_5strspnsvcauth_lgto_update_cachexdr_NSR_LOOKUP_argsstat_get_stblksize_funcasdf_read_and_unwrap_sectionnwora_sbt_errorInit_cv_Init_hashtabnwora_get_res_file_type_and_commentAsm_nerrsprintby_utf8isdigitnde_dircont_funcnsrdmpix_set_tape_positionget_nsr_t_varpca_set_dircont_funclnm_error_set_i18n_msgfinal_posix_crclgvsprintfasdf_output_section1mm_direct_file_setupclntmm_sstart_5xdr_nsrfx_querysysconfnsr_t_clean__makedevuseAliaslg_unlinkxdr_NSR_RSTART64_argsrap_retrievelg_thr_killuca_fsidxdr_idxrec6asm_access_funcdxuldm_read_invisfind_nsrmmvolumetemplateclntpbcs_status_1nsrrm_sessionuca_exttypeclu_pathl_addpath__lgto_xdr_floatlg_ts_gethostbyaddrsbtcommanddxuldm_freesaveinfoattrlist_setca_fileid_funcswapasm_savexdr_MMDB_SELECT_VOL_argsskip_zeroesxdr_MMDB_UPDATE_VOL_OP_argsmemcpyxdr_MMDB_FETCHVOL_BARCODE6_args__lgto_clntudp_bufcreateis_renamensr_serversxdr_ssfrag5_tmm_set_storage_node_is_32bitlg_argvcatclntrm_monitor_device_done_async_2ansi_fputsdirhdl_get_filedes_funcxdr_RM_SAVE_NEED_argsonce_liblocal_p_varpgetservent_rnwora_strcmpdonefstabMs_isnoozedxuldm_freerecoverinfoclntpbcs_end_1strstrlnm_stream_end_filexdr_vol_lstclu_is_cluster_hostxdr_pbcs_errorxdr_create_replyxdr_ssclone_tmm_retrieve__lgto_xdr_rmtcallresis_disk_backupclntmm_ichunk_5asdf_verify_seeklnm_nw_sess_closeclu_pathl_addlogicalhosts_solarishsm_save_funcxdr_mm_errorForgetnameonce_mif_t_varpclntmm_setup_save_session_5rmdirsepxdr_rm_sessionxdr_nsrfx_handlesetup_raplogfiledevice_enabled_to_strpthread_oncerap_p_initrand_rfile_li_get_fsidis_utdmnsr_rap_volopclnt_authlgto_createauth_create_defaultwalkclntmm_direct_file_retrieve_bcnt_5xdr_MM_ICHUNK_argsssid_parseuca_nlinkxdr_pb_id_tget_nsr_p_varpxdr_ssoff_tclntmmdb_select_vol6_6xdr_RM_MONITOR_DEVICE_DONE_OLD_argsxdr_PBCS_SNAPSHOT_argsuca_uidresidlist_printis_yesget_client_id_strgetBflglgcatclosesbtpc_object_sbtpcstatusgetAliasgetpathparentxdr_rm_mountresfp_markerrorsbtinfo2resinfo_getnwora_sbt_free_globals__lgto_xdr_unionclntrm_check_fs_done_async_2err_dupxdr_client_id_mapclntrm_save_need_2ssncommon_set_callbackadd_data_arealgto_otg_hsm_initrap_bindxdr_RM_DEVOP_argsxdr_nsrfxmanage_actionlg_ts_localtimegetHomepath_concat_dirsepclntmm_one_ichunk_5ssid_to_ssid5stat_get_stmtime_funcgetCfpxdr_pbcs_status_respthread_createreaddir_rxdr_idxrec6plg_dir_isempty__lgto_xdr_opaqueabortsvc_invalidate_otherspb_init__lgto_xdr_des_blockxdr_mm_eropindex_purgelistxdr_MM_IREC_SETUP_argsclntmmdb_asm_data6_6lg_mktimeproc_cleanupclu_pathl_normalize__lgto_seterr_replyget_reply_verifierxdr_MM_CHECK_FS64_argsget_rap_t_varpxdr_PBCS_CLOSE_argsxdr_MMDB_SET_CLIENT_ID_MAP_argsis_instance_busyxdr_lgtoauth_reply_oldnsr_volumesdcmprssuserlist_checkxdr_idxrec6ais_ipaddris_dxuldmsbtpc_object_pb_inquiryclntmmdb_fetchvol_barcode6_6pb_endsetMynameobjectlist_cmpdir_io_file_direntry_bzeroliblocal_t_cleansbtpc_object_sbtpcstart_restorexdr_pbcs_inq_osm_md_size__lgto_svcudp_bufcreateclntmmdb_enum_all_locations6_6utf8_mknodclu_pathl_addvirthostsNETUTDM_dm_init_fsxdr_vallist_pstat_get_stattr_funclnm_buffer_createxdrrec2_createxmallocxdr_RAPPROC_DELETE_argsputcxdr_NSRFX_LOOKUP_6_args__lgto_get_myaddressmmdb_query_allnwora_find_nsrresar_freefile_get_stattrxdr_MMDB_FETCHVOL_ID6_argsss_cmp_funcasm_open_funclg_thr_createswapasm_countrpc_p_initi18n_vallist_addsortstat_get_statime_funcxdr_checksumattrlist_replacexdr_MM_ICHUNK_SETUP_argsmm_rendferrorlgto_encode_ocredattr_cmpxdr_MMDB_FETCHSS_TIME6_argsUse_immediateclntmm_direct_file_save_5xdr_mverlistobject_freemm_clonestartxdr_MM_DIRECT_FILE_RETRIEVE_argsssidb_to_ssxdr_rlistssid32_tsbtreadxdr_MMDB_ASM_DATA_argsuca_freeupdate_clients_list_cachelg_thr_getidsbtpc_object_set_errorli_alloc_funcheadasm_saveasm_read_funcxdr_sha_digestfsyncsbtpc_object_sbtpccanceldebugprintfclu_pathl_createstrtolxdr_MM_DIRECT_FILE_RETRIEVE_BCNT_argslgui_create_specialxdr_nsrfx_sessionsxdr_vol5_lstget_auth_metod_nameget_num_processorssyscalls_utf8decjukebox_device_hostget_asm_t_varpsbtpc_object_pb_savenwora_validate_res_filelg_mtx_destroyNETUTDM_dm_handle_to_pathattrlist_getvalueca_set_size_funcfind_nsrresdbbigasm_countxdr_PBCS_POSTPARE_argssbtpc_object_set_up_stagingmm_monitor_deviceKey_asm_t_varplnm_stream_write_sfheaduca_is_odir__lgto_svcfd_createprintprotoioctlnsr_endlgfcloseget_rap_p_varplgui_to_stringgetAliasMntca_hardlink_path_addr_funcfreedirlistclntmm_setup_recover_session_5ca_setup_funcgetPermvallist_removevallist_countlgcatgetsasm_has_fileid_funcasm_skip_holes_funcxdr_pb_parms_tgetEncryptedkeyftruncatenwora_get_appid_keyix_ssid_to_namenew_ssstat_getpwd_funcmm_write_labeldevice_fulllg_ts_gethostbyname__lgto_xdr_u_shortindex_free_handlelgettznamevdfprintffind_jbconfigfilesetlocaleDefaultsfuncsclntnsrfx_end_5xdr_ssfrag_tnsrdmpix_index_setupmunmapasm_lseek_funccomp_lg_timeacl_count_funcxdr_MM_HANDOFF_argsca_exttype_funclg_localtimexdr_mm_replyxdr_ssreq__lgto_xdr_time_tPosixCRC_wrappersvc_server_statssigaddsetNETUTDM_dm_handle_freexdr_MM_ONE_ICHUNK64_argslg_ts_readdirxdr_RM_ERROR_argslocatecoreobjectlist_countsbtpc_object_sbtpcstart_backupclu_has_cfs_lc__lgto_xdrmem_createlog_entry_timeworkaroundxdr_MMDB_DELETE_VOLUME_argslgto_rpc_pingstat_get_stsize_funcgetModeclntpbcs_retrieve_metadata_1__lgto_xdr_freexdr_NSRFX_INFO_6_argslnm_buffer_destroyresid_cmpnumlg_dirnamesavedirsetmntentfile_fini_save_handlexdr_clientattrsvrc_chdir_funcXlateasmnamenwora_skip_whitespaceclient_list_remove_bynameread_hostids_fileasdf_null_handlerxdr_NSRFX_MANAGE_argsget_ss_bynameasm_chdir_funcxdr_MMDB_UPDATE_SS6_argsxdr_MM_CRSTART_argsxdr_authlgto_credxdr_MMDB_HINT_argsnsr_lookupdf_read_directrpc_p_cleanfile_li_get_pathxdr_RM_LABEL_DONE_ASYNC_argsxdrimmediate_detachqueryhand_callclntpbcs_discover_1svrc_close_funcrap_svcrunNETUTDM_dm_get_configfind_nsrlogfileca_has_fileid_funcsvc_ping__lgto_xdrrec_createxdr_NSRFX_MANAGE_6_argserr_setxdr_LGTO_AUTH_argsutf8_opendirnsrrm_last_update_timexdr_ntexttypeNETUTDM_dm_handle_to_fsidlgpurify_is_runningdrop_ssiddlsymvallist_findclntmmdb_update_volume_5xdr_nsrfilenamedf_retrieveasdf_hfs_catalog_recoverlg_thr_idsequalclu_pathl_free_solarisdfsave_donedir_io_direntry_bzero_func__lgto_rpcb_getaddrval_updatenwora_allocate_magic1_metadatalg_get_logsdirxdr_pb_inq_proxy_txdr_ssnchnl_stdio_msg_lginitxdr_mmretrieve_replyclntnsr_start_2getResetArchiveBitshmem_mapcomp_u_timelnm_nw_sess_createos_vers_major_numhand_client_auth_methods_stringxdr_pbcs_handlelist_print_attrclntlgto_auth_3metadata_count_funclg_wvfprintfxdr_pb_object_type_txdr_vallistxdr_mm_handoff_replysbtbackupSkipnameget_client_cache_update_styleNETUTDM_dm_getall_tokensxdr_mmdb5_rangelnm_error_set_errnoxdr_PBCS_PREPARE_argsasdf_xlate_unwrapgetlrset_client_namespacenwora_pipeutf8_accessbfsearchxdr_nsrfx_statdf_alltimes_cachedattrlist_matchwrite_sockreshand_call_logHoleyPercent_Retries_Rap_Seq_Errregex_execxdr_ctxinfoget_rap_localeget_auth_metod_numberclntmmdb_fetchss_prev_5xdr_attrlist_pvallist_find_uniquestat_get_stino_funcclntmmdb_update_vol_op_6nsrlib_initNoireadstrncat__lgto_xdr_free_pointerxdr_rlistp_tGlobal_asm_t_varpcomp_lguigetgroupsget_unc_host__lgto_authsys_createxdr_MM_RSTART64_argsxdr_mlookup_replyvsnprintfxdr_RM_BROKER_UPDATE_ASYNC_argsnsrdmpix_index_endxdrimmediate_createnwora_sbt_format_msgxdr_PBCS_END_argsca_mtime_funcget_saved_gidsfile_set_stnlinkpathlist_add_a_clushostnon_asdf_save_dataxdr_ssc_infoi18n_nctimexdr_NSR_SAVE_argssamehostGroom_prefixmm_crstart_ajb_poll_serveruca_atimexdr_lgtosvc_parms_oldmm_direct_file_more_roomnsrrm_messagelg_mtx_unlockasm_init_verify_handle_funcstrncpyutf8_to_wcsresdb_querypatca_catype_funcX_nodelayeorlg_wfputsNETUTDM_dm_create_usereventxdr_NSR_RSTART32_argsstat_set_stattr_funcutdmapi_library_closexdr_MM_ICLONE_SETUP_argsrap_cryptonce_rpc_t_varpnwora_update_SID_in_res_fileNETUTDM_dm_read_invislgcatopenNETUTDM_dm_get_log_levelxdr_attrlistclu_is_locallogicalhost_solaris__lgto_pmap_getportclntnsrfx_null_5get_utf8_codesethand_numberfile_skip_directoryxdr_lgtoauth_parmsclu_hosts_matchbynamerap_retryerrsdir_io_file_get_filenofetchvol_barcoderap_set_query_onlylnm_nw_sess_dumpnsrrm_progressNETUTDM_dm_get_eventlistclnt_sperror_rpc_errxdr_RM_LAST_UPDATE_TIME_argsis_coversetstrncmpnsr_direct_index_setuppb_attrlist_finddxuldm_write_invisnwora_sess_destroynwora_get_resources_from_res_fileget_mif_t_varpset_lgto_auth_uname_overridegetdtablesizehand_booleanxdr_ssids5_tSwapasmnamegetNsrTmpxdr_volr5_rsltxdr_MM_SEND64_argshostlist_cach_new_hostGlobal_liblocal_p_varpfetchvol_nameadd_idadd_to_environmentfind_nsrresfilesetAliasInfoca_sizeof_funcutf8decodeclntmm_crstart_5xdr_LGTO_AUTH_OLD_argsxdr_NSRFX_UPDATE_argslg_int64str_bufuca_symlink_pathuca_ctimexdr_times64_t__lgto_tcpping_svcxdr_nwbsa_objectsize_tvallist_sortNsr_gd_lvalrpc_t_needs_initis_rollover_savesetideqasm_open_verify_handle_funcxdr_nwora_fiddfopen_filehndllg_userlist_nerrsclntmm_bufferdone_5setrlimitindex_path_to_hostnwora_device_file_lstatnew_volumeclu_pathl_getmounts_lcnwora_get_resource_from_listNETUTDM_dm_request_rightclntmmdb_delete_volume_5dupNamebufindex_setxdr_NSRFX_STORE_6_argsxdr_PBCS_INQUIRY_argslg_uint64str_buffile_li_set_pathget_saved_uidsnwora_env_find_in_nwpathca_ctime_funcclosedirget_client_name_from_idget_liblocal_p_varpNETUTDM_dm_path_to_handlenwora_sbt_dump_globalsclntrm_label_done_old_2Mntasmnamensrrm_indx_setinfoi18n_vsprintfvprintinfolgui_createmm_crstartliblocal_t_initasm_readlink_funcclntmmdb_null_5xdr_nwbsa_copygpname_tsbtendclntmmdb_null_6i18n_char_nomerge_ssidslg_wvprintfNETUTDM_dm_make_handlexdr_MM_IRETRIEVE_argsadd_ssidattrlist_removelg_ts_getprotobynameonce_rpc_p_varpget_lp_full_usernamexdr_odirentryfilterodditiesxdr_MMDB_NEW_VOLUME6_argsKey_rpc_t_varplgto_gethostbynameclu_init_lcclntmmdb_fetchvol_family6_6xdr_handoff_infoattrlist_mergexdr_NSRFX_DELETE_SS_argslg_get_indexdirutdmapi_global_handlexdr_MMDB_NEW_SS_argsxdr_pbcsstatxdr_rstatus_replyxdr_volr_rsltdxuldm_setrecoverstate__lgto_xdr_pmaplistxdr_rm_progressxdr_nsrfx_qtimeclu_pathl_freeclu_dflt_namememsetacl_save_funcattr_newxdr_ctxpriorityfind_nsrrapdirHA_getcurstate__lgto_xdr_rmtcall_argsprintdirxdr_stringpclntrm_broker_2free_client_hostlist_cachevallistbyaddrdo_mm_rap_oplnm_index_destroyuca_is_asdfclntmmdb_update_ss_5get_volumepb_setup_msgxdr_pbcs_get_version_reslg_wfprintfdevice_pathxdr_dosdirentryxdr_MMDB_ASM_DATA6_argsgetmntentset_get_auth_methods_calloutnsr_p_cleanfreadclntmmdb_fetchvol_id6_6removedirentrylg_timeoffset_to_64volid_to_sessionidrpc_p_needs_initrestloc_cmp_funcclus_get_vfstabs_solarisattrlist_build_strvallist_patmatchxdr_fsattrimmediate_marklgui_is_zeroidhlink_save_funcxdr_pbcs_inquiry_resnsr_getserverhostutf8_mbslenxdr_rm_idxprogclntmm_send_5xdr_MM_WRITE_LABEL_argserr_freerestype_getdo_alignmentis_local_savesetPin_on_creatensrports_auth_serverasdf_recover_decosf_aclnsrrm_closexdr_nsrpathDefault_arsvc_req_clientlog_i18n_long_timenwora_env_dumpNETUTDM_dm_set_return_on_destroyclus_get_service_hostnameisave_cleanupuasm_recover_dataresinfo_printxdr_LGTO_REAUTH_argsxdr_MMDB_FETCHVOL_ID_args__lgto_null_authlnm_logger_return_file_ptrcreate_fdtableclnt_buf_createca_free_funcxdr_exttypexdr_MM_SETUP_SAVE_SESSION_argsxdr_MMDB_FETCHSS_RANGE6_argsnsr_set_calloutssncommon_xprt_to_msgssnlgpcloseendpwentfind_nsrdefaulttmpdiruca_ext64bitfilenwora_create_resourceadd_fragnsr_attr_packdir_io_file_get_filenamexdr_nsrfx_sinfofetchcvr_idQuitnwora_get_file_typelgto_acceptnsr_getendofdaycalibrate_xdrcopyclntlgto_reauth_old_3lg_cstrptimeclu_pathl_hostpath_matchasm_statfs_funcli_set_fileid_funcxdr_RM_MONITOR_DEVICE_DONE_ASYNC_argslg_mkdirpathclntnsrfx_delete_client_6_6gethostnameindex_connectsysinfoxdr_rm_labelreslist_addrpcport_initpthread_joinclntrm_label_done_async_2lnm_logger_msgpthread_cond_signalfchmodget_client_vlrm_label_failshutdownutf8_mbstowcsPw1namelnm_index_lookupdelete_volumesetHomess_objectlist_addasdf_recover_logasmcopy_archfile_to_tmpfileget_client_namespace_lg_thr_libinitfile_set_stblocksasm_has_skip_holes_funcraperr_from_opis_valid_poolxdr_vol_tclntrm_error_2svc_req_get_lgtoauth_parmsca_copy_hardlink_path_funcssncommon_default_usermsg_handleroutput_saverecmm_setup_recover_sessionAsmrfuncsnsrports_systemclntrm_last_update_time_2rawasm_queryendmntentmailasm_recover__lgto_xdr_replymsgZero_lguimm_direct_file_retrieveBogus_sumext_count_func__lgto_xdr_arrayclu_dflt_name_lcfile_init_verify_handlerap_get_sessionnsr_getclientsindex_lookup_1xdr_nwbsa_uint64_sxdr_nwbsa_uint64_tnde_free_funcindex_lookup_6xdr_PBCS_SAVE_argsnsr_volumes32set_clientname_dbhand_user_RO_stringstat_get_stisencrypted_funclg_get_applogsdirxdr_MMDB_FETCHVOL_BARCODE_argsxdr_retrieve_resultsverify_holelg_find_installdirdxuldm_freerecoverstateasdf_recover_dgux_metadataHA_getmasteredlnm_index_remove_SSIDliblocal_p_cleanpb_attrlist_freexdr_v5idxrecmm_recover_spacelg_is_forever_timelg_get_etcdirisprintsaveasmscleanup_mixed_codesetsxdr_MM_READ_LABEL64_argsi18n_char_yesasdf_restore_cache_is_emptyclntpbcs_postpare_1clntmmdb_fetchss_range6_6volid_createxdr_MM_LOAD_BACKUP_IMAGE64_argsutf8_link__lgto_xdr_callmsgattr_elem_freexdr_NSRFX_DELETE_CLIENT_6_argslg_close_mostutf8_fplg_ts_getpwuidxdr_versions_replynde_nextentry_addr_funcextern_recoverreaddautf8_unlinklg_ts_tmpnamxdr_getids_replyca_ext64bitfile_funcres_duplg_strtoi64pbobject_list_elem_cmpitypetoixdr_mm_movingset_policy_cacheutf8_lstatNETUTDM_dm_create_sessionirmcp_cmp_funcmkexecpathxdr_ssnchnl_start_reqget_sslnm_nw_sess_open_restoreonce_rap_t_varp__lgto_xdr_rpcbutf8_fdx_debug_write_statsnwora_sess_close__lgto_xdr_callhdrutf8_wctombenum_ss_namesidallochand_yesnofind_nsrdirxdr_ssreqa32lg_thr_initca_set_ntattr_funcobjectlist_dupxdr_ndirentryxdr_nsrfx_lastxdr_pb_object_tclntmm_ichunk64_5clntmm_rend32_5nsr_index_endmmdb_get_errorrpcport_validate_portX_noreadvrap_updatexdr_MMDB_DELETE_VOLUME6_argspthread_mutex_initlg_forever_timeoffsetsettimesxdr_mm_set_cdi_tclntmmdb_fetchvol_family_5Defaultrfuncsxdr_nsrstatussbtpc_object_post_pb_restoregetpathparent_dirseplg_userlist_lvalutf8_rmdircache_freedaxdr_ntextattrNETUTDM_dm_quiesce_fsConflict_prefixis_cluster_typeclntmm_deactivate_5lg_thr_destroysbtpc_object_sbtpcvalidateSdirfuncsclntpbcs_init_1nwora_delete_resource_from_res_fileuca_mtimeasdf_recover_hpux_acl__lgto_rpc_dtablesizeclntmm_irec_setup_5lnm_nw_sess_destroyxdr_nwbsa_resourcetype_tnwora_stricmpgetCCflgdfcloseasdf_recover_decosf_quotadatapb_postpareclntmm_setup_clone_recover_session_5lg_thr_exitmondaemon_checkhand_choicensr_amount_bytesspawnparse_auth_methodsclntmmdb_manage6_6clntpbcs_inquiry_1mmdb_controlutf8_mkdirclntmmdb_manage_5__get_rpc_createerrclu_has_cfsattrlist_hasattruca_blocksnworapc_pb_attrlist_addxdr_rm_priorityindex_crosscknworapc_pb_object_createclntmmdb_fetchvol_location6_6getpeernameonce_rap_p_varplg_thr_yieldasdf_posixcrc1_unwraplgto_reauthresid_setclntmmdb_fetchss_prev6_6is_quittokenizeclntpbcs_error_1lnm_stream_createget_clone_xdrslg_wgetenvpthread_attr_setscopeclntpbcs_null_1file_li_set_fsidrap_t_needs_initasdf_get_more_dataupdate_posix_crcopen_consoleclntnsr_versions_2getvfsentType_info_cache_last_resetreload_client_cachemm_sendfullcanonclntmmdb_fetchvol_name6_6nwora_validhostuser_fpstatattr_bzero_funcxdr_ichunk_recitem__lgto_pmap_setfetchvol_familyNsr_gd_nerrsset_lginit_uid_flagcache_initdanworapc_sess_sbtpcendbin2hexascclntrm_event_2adddirsepnwora_sess_open_backupxdr_NSRFX_END_argsansi_mbslenbigasm_recovernde_initxdr_pbcs_environment_resnwora_sbt_set_trace_file_nameutf8_wcstombslg_uint64xstruser_fdlg_remove_pathsimilarnamessbtpc_object_sbtpcstartnsr_amountisasciiHoleyMinxdr_rm_volseltype_init__lgto_svcauth_unixget_admin_name_and_typexdr_MM_CHECK_argsxdr_rstart_replygetNameclntmm_load_backup_image_5xdr_odosattrnum_chars_in_utf8_stri18n_short_timeleveltonameXlate_wrapperdfc_cleanfile_li_alloc_PROCEDURE_LINKAGE_TABLE_xdr_short_ssc_infosr_opq_to_clrli_get_fileid_funcsbtpc_object_set_statusnwora_sbt_traceli_set_num_funcasctime_rasdf_recover_pw2asm_passwordxdr_nwbsa_objectdescriptor_svallist_printxdr_nwbsa_objectdescriptor_tdxuldm_reset_atimei18n_rapattrnsr_getrecurringdateauthlgto_login_createclu_initis_mirror_volumelg_time_cmpclntmm_handoff_5memcntluca_fileidgetreqset_xprt_registerlnm_stream_read_sfheadclntmm_rstart64_5asm_write_funcNETUTDM_dm_query_rightobject_dupfile_set_stdevHoleynameclntlgto_getnonce_3ondbgintrlg_get_moddirrap_p_needs_initsbtopennwora_file_accesstimeval_diffget_device_enabledlg_get_rapdirnwora_expand_symbolic_linkdxuldm_getrecoverinfoclntnsrfx_lookup_6_6innetgrutdmapi_invalid_handlefullpath2resfile_openis_device_loadedssncommon_route_resp_onlystat_get_stisdjunc_funcvallist_cmp_exactpb_discoverasm_has_reset_atime_funcpthread_selfclntnsr_null_2xdr_MMDB_FETCHVOL_POOL_argsRecv_immediatenwora_print_statusSvcdb_cleanupstristrnwora_strip_whitespaceclntrm_session_2nwora_sbt_set_initializedpb_retrieve_metadatautf8_utimepb_statusxdr_ssclone5_tindex_vers_strxdr_pb_object_subtype_tobjectlist_findxdr_mmstatusxdr_NSRFX_INFO_argsclu_get_vhost_mntentsvcauth_disable_auth_checkNot_lguinworapc_sess_destroyxdr_nsrfx6_qtimemm_load_backup_imageget_nsr_serverfile_init_save_handlelg_strtoui64residlist_addtasxdr_MM_RSTART32_argsshmatasm_link_funcget_longestlengthclntmm_crstart_a_5clntmm_direct_file_retrieve_5is_myaddrclntrapproc_getids_3xdr_RAPPROC_UPDATE_argsxdr_ounixfileidxdr_LGTO_PARMS_OLD_argsreslist_dupindex_delete_ssis_immediate_savedir_existsresid_print__lgto_xdr_u_intbsearch_arrayasm_stat_funcDo_bogus_sumclntmm_null_5xdr_PBCS_STATUS_argsca_is_odir_funcnwora_strrstrNETUTDM_dm_get_appl_flagsnwora_env_initstring_to_lguixdr_ss_lstlg_time64_to_offsetasdf_recover_hpux_aclvca_nlink_funcsbtrestorensr_getaccessclientsrm_monitor_device_doneca_set_blocks_funcstat_get_stnlink_funcxdrfdbuf_createxdr_RM_EVENT_argsutf8_chmoddir_io_direntry_get_fileno_funcnde_nextentry_funcstatattr_copy_funcshmdtequal_localesfile_li_get_nextxdr_lgtoparms_reply_oldBigasm_progress_KBset_xprt_unregister_fcnsetsockoptnsr_bind_recov_mmlnm_stream_writesendtocan_cross_platform_recoverclntrm_event_async_2strcasecmpmmdb_serverxdr_mbstypeonce_liblocal_t_varpasm_parsesigprocmaskxdr_save_requestvallist_find_poslgui_create_oldlgto_getcwdxdr_RM_SAVE_NEED_OLD_argsDefaultsdirfuncsclu_get_local_vhost_listclntmm_read_label64_5protomem_nochdirgetlocalhostHAnwora_env_getoptget_immediate_buffetchss_prevli_set_fsid_funcget_user_localeext_save_funcxdr_rap_event_notification_args__lgto_xdr_authunix_parms__lgto_xdr_intgeteusernamexdr_nsrfx_endopmm_get_device_and_hostxdr_PBCS_INIT_argsnworapc_sess_sbtpcvalidatexdr_nsrfx5_statxdr_ssnchnl_message_headernsr_resdb_updatexdr_MM_SET_BACKUP_STATUS_argsget_Svcdbfile_set_stsizelnm_index_vol_t_lookupca_is_direntry_funci18n_gmt_ctimeparse_auth_methods_to_intxdr_MM_SETUP_RECOVER_SESSION_argsfetchvol_idsasm_skip_directory_funcxdr_RM_BROKER_UPDATE_OLD_argsxdr_MMDB_ENUMSS_NAME6_argsasm_t_initlg_get_coresdirca_rdev_funcgmtime_rnworapc_sess_sbtpcstatusclu_is_localvirthost_lcca_set_ext64bitfile_funcfile_init_recover_handlegetprotobyname_rhand_rangeis_utf8_mbserr_setallalloc_bufferfile_open_recover_handleasm_okpath_funcnwora_env_loggercan_direct_remote_recoversetvbufxdr_ssidb_tMy_buf_align__lgto_xdr_referenceclntrm_save_need_old_2__lgto_xdr_charincrRecovererrpNETUTDM_dm_path_to_fshandlelnm_buffer_joinfetchss_rangexdr_lgtoparms_replynwora_versionstringget_read_bufrap_getidsxdr_MMDB_FETCHSS_TIME_argsnwora_get_nwora_versionxdr_mm_actionqueryhand_setuca_rdevfile_renamefileca_set_hardlink_path_funcxdr_pb_status_tindex_storeuca_set_odirlg_wperrorverbprintasm_init_save_handle_funcrecover_sr__lgto_xdr_stringnsr_exitis_device_definedlnm_nw_sess_open_backupxcallocgetanother_emitteritemprintdalgsoblockrefresh_type_info_cacheAuth_methods_listlg_wputenvnsrports_dbNETUTDM_dm_sync_by_handlexdr_svc_encode_clntcredtype_findmm_setup_clone_recover_sessiontypelist_freesvrc_open_funcclntrm_devop_2pmap_fallbackasm_datainfo_default_etextclu_is_cluster_host_lcNsr_read_alignxdr_rm_unmountclntnsrfx_start_5xdr_mmdbmanage_actionnde_is_dircont_funcgetMaptonametolevelsysdesc2uca_is_regssid_volid_parselgto_otg_hsm_file_attr_recoverxdr_MMDB_FETCHVOL_LOCATION_argsclntrm_broker_update_2is_in_time_arrayxdr_rm_devopdfopenxdr_pb_inq_ssunit_tis_utf8_mbnsr_sc_initdlclosestat_set_stino_funcca_is_dir_funcxdr_MMDB_MANAGE_argsnsrrm_controlxdr_stage_tsbtpc_object_createis_mynameclu_has_single_inst_cnflctis_recycle_from_other_poolsxdr_data_shufflexdr_nsrfx6_lookup_res__lgto_xdr_fdswapasm_querypb_attrlist_dupindex_infoxdr_ssnchnl_reqtypeNETUTDM_dm_path_to_handlesxdr_short_time64_tget_dflt_index_pathonce_asm_t_varpasdf_cvcompress_unwrapadd_clonedirection_stringcompress_filterindex_startperm_checkNETUTDM_dm_make_fshandlepb_closeasdf_recover_solaris_extmif_t_cleannsrrm_report_eventssncommon_destroy_callback_entriesupdate_ssrap_authorizeerr_dup2nwora_destroy_resourceNETUTDM_dm_handle_to_inois_validhostnamerm_check_fs_doneAsmsfuncsreslist_parsefp_noerrfree_dns_hostlist_cacheclntrm_label_fail_2nworapc_sess_initlg_ts_getservent__lgto_svc_sendreplyretrvhand_typessbtpc_object_sbtpcrestoresvc_set_skip_host_authxdr_RM_NEWSESSION_argsli_get_num_funcansi_mbsclus_get_hostnameresidlist_duppb_environmenterr_restorereslist_printrm_label_donerap_deletedevs_on_multi_hostsxdr_nsruattrforkNETUTDM_dm_set_trace_leveldestroy_freedaxdr_NSR_VERSIONS_argsgetservbyname_rrpcport_get_unusedxdr_ssaverecnworapc_sess_get_object_by_idxdr_NSRFX_DELETE_SS_6_argsis_client_ndmpacl_file_initsvc_dispatchxdr_PBCS_ERROR_argsca_odir_funcmm_null_oldres_typecheckxdr_pbcs_discover_res__lgto_xdr_boolca_set_catype_funcfile_set_stattrclone_has_volxdr_NSR_START_POOLS_argsvallist_add2lnm_stream_readfind_nsrimcheckresdb_setinet_netofclntmm_iretrieve_5find_nsrlaresfileclntmmdb_enumss_name6_6is_on_hostlchown__lgto_clnt_pcreateerrorclntpbcs_get_version_1lg_get_argv0svc_getreqset_varpednsr_versionsgetpathchild_dirsepca_uid_funcclntmm_cloneend_5clntnsrfx_sessions_5lg_int64strxdr_ss5_tasm_seekdirucaseresfile_lockutf8_ttystrlenutf8_chdirnsr_get_calloutmmdb_get_client_id_mapxdr_PBCS_OPEN_argsCompressasmnamexdr_mbs_itemclntnsrfx_manage_5mm_nullxdr_rlistssid32p_tasm_mkdir_funcset_global_auth_methodsxdr_rm_label_shortreslist_findclntlgto_auth_old_3Mtimeasmnamelnm_flockxdr_MMDB_FETCHCVR_ID6_argsdxuldm_initprocstatesbterrorxdr_MMDB_GET_CLIENT_ID_MAP_argsgetpathchild__lgto_svc_getreqsetwaitpidclntmmdb_fetchss_time_5clntmmdb_delete_ss6_6pthread_mutex_unlockasdf_posixcrc_unwrapxdr_MM_CHECK_FS_argsasdf_compress_wrappthread_setcanceltypecleanup_mapperscheck_devhost_consistencynde_alloc_funcNETUTDM_dm_set_session_flagsfile_li_set_fileidcheck_ss_cutoffpthread_exit__lgto_xdr_wrapstringNETUTDM_dm_set_fileattrxdr_RM_CHECK_FS_DONE_argsrawasm_recovernsrrm_hostfile_get_stmodeNETUTDM_dm_set_appl_flagsxdr_ndmp_bridge_status_nsr_mallocxdr_RAPPROC_GETIDS_argsstrtouli18n_char_renameclntnsrfx_start_6_6index_pconndrop_clonexdr_sfheadattrlist_typeForce_debugasm_readdir_funcattrlist_intersectca_direntry_funcclntmm_rstart32_5xdr_srecaprntimefile_li_set_nextrpcport_set_reservednworapc_object_id_creatensr_get_sstimexdrrec_splicerpcport_printxdr_pb_op_trestoreNamebufxdr_reslistparse_client_auth_methodspthread_cond_waitclntmm_ichunk_setup_5xdr_mmdbasm_actionuca_sizeclu_get_vhost_mntent_lcis_sn_ndmpretrvhand_calluca_hardlink_pathlg_ftrunc64NETUTDM_dm_get_dmattrlistenclu_pathl_gethostclu_get_specified_nsrdirssname_may_be_indexget_primaryclientnamesetasminheritlg_wprintfnwora_find_in_pathnwora_create_metadataxdr_nsr_dtypegetLogfdxdr_ss_rsltnsr_resdb_netvallist_addget_curr_mm_versutf8_getcwdlg_unlckflasdf_clear_restore_cachemetadata_file_inituca_is_direntryuca_clear_ntattrxdr_rm_monitor_devicepthread_attr_setstacksizensr_rpathclntmmdb_fetchss_id6_6utf8_chownget_host_auth_methodsclntmmdb_fetchvol_pool_5nsr_retrievexdr_client_id_rsltattrlist_equalix_ssname_to_idLiheadset_use_atexitNETUTDM_dm_get_fileattrget_client_idxdr_idasmar_initfind_nsrmmvolumefind_nsrnetworkrclntpbcs_prepare_1xdr_rm_stage_infoutf8_readdirasdf_recover_aix_acllgto_auth_decodedebug_checkxdr_osaverecsha_initxdr_RM_CHECK_FS_DONE_ASYNC_argsgetlocalhost_lcxdr_MM_RETRIEVE_argsget_unc_obj_typeget_index_ss_name_readableServer_typesset_recover_server_is_32bitca_is_dircont_funcreslist_putresinfo_freensrports_get_admin_portsxdr_PBCS_RETRIEVE_METADATA_argsstat_get_stblocks_funcuca_set_ext64bitfileuca_is_symlinkrap_session_destroyfile_is_relative_pathnsrrm_indx_setprogressattr_to_boolnworapc_pb_errorclntmm_check_fs64_5deleteAliasInfoutf8_fopenasm_compute_quota_funcget_client_ostypexdr_ssreqasetrapcryptkeypb_openclntshould_encrypt_3utf8_mbs_tolerancestrcat_reallocxdr_nsrfx_start_reslg_cond_timedwait__lgto_svctcp_creategethostbyname_rnote_mbs_versionxdr_nsrfx6_timerangeliblvars_set_debuglnm_error_destroyclntnsr_volumes_2nwora_sess_dumpfetchss_name_attrres_include_updated_attrs_onlyfreopenasdf_find_handlerour_license_stringlg_wstrerrorclu_get_local_vhost_list_lcnsr_findindexlgto_otg_hsm_countsbtwrite2strncasecmpunc_skip_prefixis_strong_auth_enabledxdr_MMDB_FETCHSS_NAME6_argsnwora_sbt_check_initializedget_index_pathuca_direntryvallist_addsort_exactset_ZeroSavetimesclntrm_broker_update_async_2nwora_env_set_browse_and_retentionxdr_RM_RECOVER_NEED_OLD_argsfile_open_verify_handleget_ansi_codesetoracle_asdf_recover__lgto_xdr_shortasm_closedir_funcxdr_dirct_file_rlist_tNsr_read_sizeAllownamensr_attrs2infoxdr_saverecpgetpidlgfgets_utf8sbtclose2inet_ntoaclntnsrfx_store_5file_get_stisdjuncuca_set_catypexdr_attrlist_refget_liblocal_t_varpmmdb_managesbtpc_object_checkxdr_MMDB_UPDATE_VOLUME_argsattrlist_addlistmm_versionnsrrm_brokerxdr_MMDB_MANAGE6_argssbtremovexdr_saverecnsr_t_needs_initliblocal_p_initgetmntanygen_ctxstatuslg_openlg_strvcatclntmm_check_5is_nw_tapefind_appdirlg_statvfssvc_statspthread_cond_timedwaitxdr_short_ssid_t_nsr_freelocal_saveset_listlg_mtx_lockget_rpc_t_varplgto_otg_hsm_savexdr_mm_rewindclntnsrfx_delete_client_5xdr_MM_SETUP_CLONE_RECOVER_SESSION_argslgto_index_authsocketset_lgto_i18n_rname_calloutca_gid_funcis_nt_OSxdr_rm_idxstathostlist_cache_extendxlate_filterasm_lstat_funcget_client_policiesclntmmdb_fetchss_id_5select_volNETUTDM_dm_write_invisis_immediate_bufclntmmdb_new_ss_5xdr_rm_modedxuldm_freeprocstatexdr_dispositionmm_setup_save_sessionnsr_putdateval_newlnm_allocxdr_rm_daemonis_device_readonlyfflushattrlist_defaultreslist_parsefpclntnsrfx_lookup_5xdr_mm_tapealert_tfseekxdr_u_shortennsr_get_clientnamecommand_stringgetMapfromlenclntmmdb_enum_all_locations_5x_debug_closeca_size_funcget_valid_groupsetbuffile_li_get_numca_is_symlink_funcxdr_volid5_tlgto_otg_hsm_closeclntmmdb_fetchss_name6_6idlistfreefind_nsrapplogsdirlnm_error_createasm_renamefile_funcxdr_int64_tfind_nsrmmdirfmatchca_clear_lgattr_funcNsrres_to_dateKey_liblocal_t_varpli_get_fsid_funcclntnsrfx_set_6_6clntmmdb_fetchvol_location_5once_nsr_t_varpxdr_dev_tfind_nsrresdirfetchss_idsclntmm_ichunk_setup64_5xdr_select_vol5_infosysdescpthread_attr_destroyxdr_dosfilenameutf8_symlinkrap_session_destroy_cbreslist_freehand_attrxdr_MMDB_NEW_SS6_argsrm_monitor_device_failclntmmdb_fetchss_name_5index_purgelgto_otg_hsm_openasm_close_funcnwora_check_path_lenfetchcvr_idsmbs_strlennsr_p_needs_initxdr_MM_DIRECT_FILE_SAVE_argsdo_update_vol_opsbtpc_object_destroyxstrdupidxns2attrswaitchildHA_handlelgto_authget_rpc_p_varpxdr_lookup_replyxdr_ssnchnl_start_replyxdr_NSR_START_argsxdr_rm_mount_shortstat_set_stsize_funcxdr_RM_MONITOR_DEVICE_FAIL_ASYNC_argsgetRecovererrpPost_stat_analpthread_mutex_destroynsr_t_init__lgto_xdr_opaque_authnde_set_fileid_func_nsr_openget_nsr_auth_prognsr_index_accessnwora_allocate_magic2_metadataget_unc_rootxdr_MMDB_FETCHVOL_FAMILY_argsinet_addrpthread_setspecificgetMynameuca_lgattrmmdb_convert_ix_ssnamesxdr_MM_ONE_ICHUNK_argsdir_io_file_get_stat_edatarpcport_get_range_totalget_default_auth_entrynsr_save_inactivity_keepalivei18n_rapvalNsr_gd_charcheck_acl_access__lgto_svc_registerxdr_nwbsa_objectstatus_tcs_endxdr_ssnchnl_start_req_pclnt_get_supported_auth_methodsacl_init_funcxdr_obsolete_2longclntlgto_parms_3res_freeasdf_lzcompress_unwraphsm_file_initnwora_default_nwpathxdr_MM_SSTART_argsx_debug_initreslist_newenum_all_locationsKey_rap_t_varpxdr_MM_LOAD_BACKUP_IMAGE_argsmm_handoffxdr_MMDB_SELECT_VOL6_argsxdr_NSR_VOLUMES_argssvcauth_get_usercontextvallist_insertnsr_findadminserveronce_nsr_p_varpxdr_saverec2lg_wgetsxdr_saverec3__lgto_svcerr_systemerrxdr_olookup_replylgprint_productinfoNullasmnameclntmm_one_ichunk64_5clntrm_newsession_2get_index_ss_namegethostent_r__lgto_pmap_unsetxdr_RM_INDX_SETPROGRESS_argsutdmapi_invalid_handle_ptrupdate_res_no_sequence_retryxdr_RM_MONITOR_DEVICE_FAIL_argspb_versionHA_openinfo_getflagsxdr_MM_ICHUNK_SETUP64_argsreslist_parsebufuca_copy_hardlink_pathnsrports_set_admin_portsasm_t_needs_initclntpbcs_close_1xdr_nwbsa_objectstatus_exdr_rlistssidp_tlg_cond_signalval_freeclntgen_creategetenv_ulongresid_newxdr__ntattrset_rqr_priv_portsis_mirror_devicegetpwdca_set_odir_funcxdr_RM_EVENT_ASYNC_argsdfsave_setuplg_statNETUTDM_dm_set_regionDestSvauthfallbackHeadasmnameclntrm_null_2__lgto_authenticatei18n_time_onlyuca_set_is_regUseWritexdr_MM_WRITE_LABEL64_argsclntlgto_reauth_3getservbyport_rlnm_logger_exit_msgasdf_recover_datanwora_sbt_index_creatensrports_set_conn_portsNETUTDM_dm_punch_holeclntnsrfx_store_6_6memmovevalid_dirseplg_get_mmdirresid_freelnm_index_dumpnworapc_sess_check_backup_name_collisionnde_set_nextentry_funcfind_nsrjbresfileAlwaysnameca_is_hardlink_funcinit_rpc_errlistlockfca_is_asdf_funcattrlist_to_strxdr_fastbyteslgqsortfdtable_xprt_unregisterxdr_pbcs_snap_vendorlistres_parsefpresnet_share_handledo_ref_typeisloweraddapxdrfd_createlg_lseekclntmmdb_fetchcvr_id6_6vallist_builduca_ntattrstat_get_stisdir_funcsbtpc_object_set_up_raw_file_namende_fileid_funcfullcanon_dirseplocal_bsearch_iPrintDevInfonwora_get_debug_file_loggerasm_telldirlg_ts_getservbynamexdr_rlist32p_tretrvhand_setclntmm_monitor_device_5strpbrkpopenxdr_ssid_tNsr_ichunk_headerszgetIflgstat_set_stnlink_funcnwora_sess_open_restoremm_cloneendxdrfrw2_createxdrrec_skiprecord_pendingdataxlate_recover_datashmctllgui_get_privatexdr_ctxstartxdr_deactivate_reqclntpbcs_open_1spawn_as_usernworapc_sess_add_sbtpc_objectuca_set_blocksinit_posix_crcbuild_mversions_replycrosscheckvolNETUTDM_dm_reset_parentrap_createli_set_next_funcasm_hlink_initnwora_sbt_auth__lgto_xdr_vectorstatattr_free_funcvallist_find_exactxdr_MMDB_DELETE_SS6_argsget_lang_subdirxdr_MM_SEND_argspthread_cond_destroyxdr_volumes_replyshmem_createresinfo_dupxdr_pb_impl_txdr_MMDB_DELETE_SS_argsclntnsrfx_manage_6_6mm_set_callbackNo_mem_msglgui_get_idtypeexeclplgto_otg_hsm_fini_recoverclntmmdb_update_volume6_6Mailasmnamexdrrecw2_createpb_objectlist_freexdr_nsrfx6_querynwora_env_createfwritegetNwarningsasdf_recover_nt_dataclntmmdb_new_volume_5hand_statisticsclntpbcs_cancel_1svrc_lstat_funcxdr_sstart5_replyxdr_clist_txdr_MMDB_UPDATE_VOLUME6_argsxdr_pbcs_error_ressvcauth_unix_get_usercontext__lgto_svcerr_weakauthssncommon_route_exitstatuslnm_index_set_retriesclntmmdb_fetchvol_id_5mm_checkrap_t_cleanswapasm_recoverxdr_mmdb_rangeca_symlink_path_funclg_ts_getservbyportget_primaryhostnamesstime_absolute_to_offsetNETUTDM_dm_init_servicelg_cond_waitmmdb_getstatusxdr_nsrfx_info_resclntmmdb_fetchvol_pool6_6file_statattr_copyxdr_NSR_VOLUMES32_argsbsearch_array_add_elementDevasm_modeclntnsr_lookup_2find_nsrsgprgrssNETUTDM_dm_set_log_levelfind_nsrguidirPre_stat_analxdr_nsrfx_sessions_reslg_ts_asctimeNETUTDM_dm_find_eventmsgattr_printhl_savemm_set_backup_statusnwora_make_rawasm_directiveinit_localesnsr_ichunksf_enduca_catypeprint_pbobjclntrm_broker_update_old_2lgto_otg_hsm_fini_saveuca_set_hardlink_pathLG_FD_ISSETmetadata_init_funcmm_pconnresid_cmpremove_buffering_spacensr_getscmm_chunk2nsr_startspawnthreadlnm_stream_backup_initsleepasm_opendir_funclnm_logger_msg_levelxdr_uint32_tumaskxdr_MM_MARK_argsset_do_not_use_immediatelg_ts_strtokMark_intervalswapAliasInfoxdr_rap_directionlg_ts_getpwnam___errnoNETUTDM_dm_handle_to_fshandleprint_timestampsblow_errclntmm_iclone_setup_5asdf_recover_ptx_dflt_aclres_storeli_get_path_funcxdr_MMDB_UPDATE_SS_args__lgto_svcudp_createutf8_readlinkxdr_ss_txdr_RM_BROKER_argsxdr_pb_inq_error_tNETUTDM_dm_print_handlestat_get_stdev_funcnwora_sbt_init_globalshandler_freefscanfasm_recover_unlink_funcstat_get_stisreg_funcKey_cc_t_varpvallist_displayuca_modexdr_ctxmodensr_saveimmediate_retrievegethostbyaddr_rfile_skip_holesclntrm_indx_setprogress_2mm_serverasm_init_recover_handle_funcnwora_update_resource_listfeof__lgto_svc_unregistermm_one_ichunkxdr_mm_ratessncommon_route_messagegetGIflguca_set_dircont__lgto_xdr_enumis_nonwora_env_setopt_with_stringCompress_wrapperstat_get_stctime_funcuca_is_dircontliblocal_t_needs_initerr_setstrlocaltime_rNullnamenwora_xdr_metadatagetasminheritlg_varp_threadexitMast_flaglist_appendlnm_stream_destroydir_io_direntry_get_stat_funcasdf_recover_seekexecvenwora_sess_initcompress_recover_datacc_t_clean__lgto_clnt_createnwora_check_pathwcslenlogasm_recovernwora_destroy_metadatanwora_sess_createmetadata_save_funclg_fstatnsr_get_serverexecvpvarp_setupNETUTDM_dm_get_bulkhandlespb_reset_errorxdr_pbcs_init_reslg_ts_getgrgidss5info_to_ssidGlobal_rap_p_varpclntmmdb_update_ss6_6ca_clear_ntattr_funcdrop_volsbtpccommitxdr_NSRFX_STORE_argsxdr_MMDB_FETCHSS_NAME_argspthread_setcancelstatensrrm_eventfile_okpathlg_get_glsdirclntnsr_save_2utf8_mblensha_streamxdr_MMDB_FETCHSS_RANGE_args__lgto_svcerr_noprocsameclient_DYNAMICattrlist_setlist__lgto_svcerr_noprogasm_unlink_funcfile_get_stctimeresinfo_to_infolg_time64_to_32xdr_MM_REND64_argsattr2idxnsval_print__lgto_xprt_registerxdr_rm_unopresid_duplg_stat_unlinksbtpc_object_sbtpcqueryrestore__lgto_svcerr_decodexdr_MMDB_NEW_VOLUME_argsgetsocknameclntmm_sstart64_5getpathdepthlg_uint64strresdb_typesxdr_nsrfx_time_matchfile_replace_fakerootuca_sizeofnsrrm_newsessionregex_icmpresfile_getclntmm_get_device_and_host_5protomemar_dupxdr_RAPPROC_CREATE_argsvol5info_to_volidclntrapproc_delete_3lgui_cmpsbtpc_object_dumpasm_do_checkfile_functimezoneresdb_filegetpathdepth_dirsepmm_direct_file_retrieve_bcntdefault_recovernwora_sbt_removefile_get_stisregxdr_RM_BROKER_UPDATE_argsgetFatalfree_auth_methods_listtolowerpthread_key_createerr_printlg_get_debugdirbuild_spawn_user_contextss_to_volsliblocal_p_needs_initxdr_MM_DEACTIVATE_argsstrip_mirrordevice_suffixxdr_RM_LABEL_DONE_argsxdrfr_createbsearch_array_drop_elementfetchss_timesxdr_nwbsa_objecttype_exdr_MMDB_FETCHSS_PREV6_argsxdr_rm_eventis_proc_exiting__lgto_svcauth_shortmm_ichunkxdr_nwbsa_objectowner_slginit_donexdr_nwbsa_objectowner_txdr_ss5_rsltext_init_funccreate_rpcssn_xprtnsrports_get_conn_portssetgroupsfchownvol_cmp_funcclu_path_owner_ignorewcs_to_utf8attrlist_printuser_has_remote_accessfile_get_stdevnsrports_remote_requires_reservedxdr_RM_MONITOR_DEVICE_DONE_argsuca_hardlink_path_addrlg_ts_srandlgto_decode_ocredxdr_lgtoauth_ocredCatdfile_get_stblocksxdr_MM_SSTART64_argslg_cstrftimenworapc_object_id_destroymm_rstart__lgto_xprt_unregisterxdr_pbcs_inq_mdksimilarnamelnm_free_ssinfo_tdxuldm_getsaveinfoonce_cc_t_varpxdr_update_replystrcollfile_get_statimensr_authenticatemm_read_labelopterrca_get_funcgetMigrate_criteriais_pool_auto_verify__lgto_xdr_voidindex_rmhostval_new_nospnwora_env_destroyGlobal_rap_t_varpattr_sprintfss_sortbydatenwora_save_res_filedefaultidxnsclntnsrfx_delete_ss_5atoixdr_MM_MARK64_argssstime_offset_to_absolutensr_resdb_retlistxdr_nwbsa_objecttype_tatollnm_index_ss_t_lookupresfile_fclose__lgto_xdr_rpcblistxdr_clientid_thand_queryget_native_namespacelnm_stream_mmd_restore_inithsm_init_funcgetNflgclntmmdb_delete_volume6_6uca_is_hardlinkrpcport_ensure_reservednwora_sbt_free_sbtinfo2_memmailasm_savenwora_fullpath__lgto_xdrrec_eof__lgto_xdr_u_charnworapc_sess_remove_sbtpc_and_pb_objectlnm_stream_dumpfetchss_namexdrstdio_createset_indexpath_dbKey_mif_t_varpauthlgto_get_servernwora_getenvmm_exitnwora_destroy_res_filenwora_update_res_filesbtpc_object_get_backup_metadatalg_openstdfilesfile_li_set_numclntmmdb_new_ss6_6rm_needxdr_NSR_END_argsis_valid_groupca_is_reg_funcclntmm_direct_file_more_room_5xdr_ichunks_tclntmm_write_label64_5addasmworkAtimeasmnamefile_get_stnlinkext_file_initlg_selectxdr_RM_LABEL_FAIL_ASYNC_argsgetrlimitassignEncryptedkeyNETUTDM_dm_fd_to_handlepb_refresh_envclus_startmodeLG_FD_SETregex_doneerr_accruexdr_resourceset_native_namespaceNETUTDM_dm_get_eventsxdr_NSRFX_DELETE_argsShmem_modelg_get_tmpdirclntmm_load_backup_image64_5clntmmdb_set_client_id_map_6xdr_nwbsa_description_tsbtpc_object_restore_renameattrlist_ordernsr_getserversget_volume_bynameattr_hasvaluca_clear_lgattrislikexdr_MMDB_ENUMSS_NAME_argsfdopenmm_ichunk_setupxdr_residxlate_recoverfile_statattr_freeT_threadexitasdf_recover_solaris_aclgetEflgnwora_file_nwpathclntnsrfx_info_6_6note_alldone_stdoutNETUTDM_dm_get_config_eventsprint_pbobj_elemasm_fini_save_handle_funcupdate_volumeval_cmp__get_svc_fdsetfile_ca_setuplg_cisspace__lgto_svcerr_authasdf_verify_dataclntnsrfx_flush_5find_nsrsecuredirmm_deactivaterecvfromset_privilegedrap_get_lgtoauth_parmsasm_mynameDefault_error_msgxdr_MM_CLONESTART_argsmmapxdr_ichunk_setup_resultsxdr_rchnk_tssid_createrap_t_initxdr_nsrfx_lookup_resset_calloutslnm_logger_destroyX_nowritevclntmm_set_backup_status_5vdprintfasm_fini_recover_handle_funcis_magic1resdb_typecheckxdr_pb_objectlist_tlgto_gethostbyaddrlnm_logger_entry_msgfile_get_stisreparselnm_stream_fill_bufferxdr_NSRFX_DELETE_CLIENT_argsHA_closeGlobal_nsr_p_varpstrcatnworapc_sess_createlnm_funlockresnet_refreshnwora_get_resource_from_res_filefile_do_checkfile__lgto_xdr_longxdr_MMDB_FETCHVOL_NAME6_argsclntrm_indx_setinfo_2xdr_MM_READ_LABEL_argsxdr_MM_CLONEEND_argsis_not_allowedcheck_responsefile_statattr_bzeromm_markxdr_rs_infohand_user_RO_choiceDo_not_use_immediatexdr_delete_replynsrports_set_svc_portsx_debug_init_varsget_nsr_auth_versget_vhost_by_path_lchandle_internal_argsclu_is_cluster_host_solarisxdr_nsrattrcheck_addhostxdr_nsrstatca_atime_funcssid5_to_ssidca_type_funcclu_pathl_finalizefile_statattr_allocNsr_gd_parsesbtpc_object_set_up_restore_pathsxdr_NSR_RETRIEVE_argsbsearch_array_destroyLogasmnamePw2namexdr_pb_attrlist_tgetsockoptis_valid_media_typeformat_contfilenamelg_ptrstrasdf_read_section_bodydbtob64holey_recovernwora_env_setoptget_ss_rangelgto_otg_hsm_stub_attr_recovercompress_recoverlgto_authinitlg_get_resdirrpcport_add_rangeNETUTDM_dm_query_sessionlist_addelemcs_startresdb_queryxdr_nwbsa_uint32_trawasm_readxdr_MMDB_FETCHSS_PREV_argsxdr_MM_ICHUNK64_argsgetreqset_xprt_unregisterattrlist_subsetxdr_RAPPROC_RETRIEVE_argsxdr_MMDB_FETCHVOL_LOCATION6_argsnwora_sbt_query_initializedlg_wputs__lgto_clnt_broadcastlg_creatrl_enablerpc_t_initca_is_xdev_fileno_funcGlobal_nsr_t_varpgetegidmm_direct_file_precommitxdr_nwbsa_copytype_exdr_brc_meta_osm_tapply_savestateclu_is_localvirthostnworapc_sess_dumpsbtpc_object_create_logical_pb_objectsxdr_MMDB_FETCHVOL_FAMILY6_argspopulate_pmapsstrchrsetsidrpc_set_run_loopget_unc_file_pathfile_li_get_next_addrxdr_nsr_qtypexdr_MMDB_FETCHVOL_POOL6_argsxdr_crstart_replyhand_user_RO_yesnoresdb_timeoutvallist_pos_removende_set_name_funciddupgetAllAliasNamesxdr_verlistnsr_getdatexdr_rlistssid_tisalphasvc_set_auth_callbackPin_on_mapxdr_MM_REND32_argsasdf_posixcrc_wrapclntrm_does_more_async_2pthread_cancelbigasm_saveclntrm_check_fs_done_2xdr_unixattrclearEncryptedkeyClone_immediateli_get_next_funcfcntlnwora_whatinfostat_set_stmode_funcxdr_ssreq32clntnsrfx_delete_5asdf_recover_decosf_metadataxdr_fsextensionssavefile_finiclntmmdb_hint_6xdr_nwbsa_copytype_txdr_asdf_hdrmif_t_initssid_to_sessionidxdr_MMDB_FETCHSS_ID_argsNETUTDM_dm_handle_is_validregeventcv_compressftellNETUTDM_dm_probe_holensr_dchunkSkip_holesset_alias_protospeclg_ts_gmtimexdrdfr_detachsbtread2lnm_index_cfx_range_lookup__lgto_clnt_sperrnois_server_OSshmem_secureres_parselinexdr_lgtoauth_replyNsr_avoid_archivexdr_client_cachefetchvol_locationget_lgto_auth_uname_overridensr_volumes_supporteddefault_querySbt_initializedclntmm_send64_5__lgto_clnt_sperrorxdr_ichunk_info_tlg_userlist_chargetWhenx_noabortconncc_t_initxdr_shortennsrports_initxdrrec_set_fragmaxxdr_rpcblist_ptrxdrfr_splice_outclntmm_rend64_5rap_p_cleanca_set_lgattr_funcfile_fini_recover_handlexdr_ichunk_recitem_typelg_is_forever_timeoffsetfile_set_stmodenwora_delete_resource_from_listalloc_idsrqstp_to_varpvallist_freegetmntptflgclntnsrfx_null_6_6xdr_lgui_tfind_origingetdirphsm_init_recover_funcxdr_MM_CHUNK64_argsxdr_MM_MONITOR_DEVICE_argsxdr_save_replyxdr_nsrfx6_info_respublish_rap_eventxdr_nsr_qtimeclntnsrfx_update_5fetchvol_idlist_lsearchxdr_mversions_replyvallist_dupuca_set_sizexdr_ssid5_tlg_mtx_createxdr_ssnchnl_signal_msgresinfo_findget_auth_methods_listvallist_matchset_rap_access_checkhand_stringuca_set_direntrylookup_i18n_rname_val_attrstrcpyprotofileclntrm_progress_2_svcauth_lgtogetgrgid_r__lgto_clnt_spcreateerroruca_set_exttypensr_initxdr_sstart_reply__lgto_clnttcp_createhsm_fini_recover_funcsetpwentca_mode_funcasdf_read_section_headerclntmmdb_select_vol_5ca_blocks_funcstat_get_stmode_funcmmdb_savetimesis_anydev_readonlyasm_is_relative_path_funcxdr_stage5_tfdtable_opsBigasmnamexdr_MM_DIRECT_FILE_PRECOMMIT_argsconvertDriveToUpperxdr_fs_typeclntmm_recover_space_5i18n_sprintfclntrapproc_update_3uca_is_xdev_filenoresinfo_newerr_savexdr_dupxdr_mm_host_device_replyli_set_path_funccreatedirs__lgto_authnone_createattr_dupuca_is_dirunamexdr_NSRFX_LOOKUP_argsKey_nsr_t_varpuca_odirxdr_MMDB_FETCHVOL_NAME_argsutdmapi_fdgetgidxdr_extattrlg_varp_get_idasdf_hfs_resource_recoverTry_inlinefind_nsrdebugdirFnameclntnsr_rstart32_2getadminnamenwora_sbt_setup_error_filestat_get_stisreparse_funcxdr_rm_bupdatehasmntoptxdr_fileidset_DisableCattrMessxdr_LGTO_REAUTH_OLD_argsgetAAflghand_resnwora_parse_name_val_tokenres_parsefetchss_iddelete_clonegeteuidca_set_exttype_funcmm_setup_clone_save_sessionxdr_pbcs_rcDebug_resfile_errnoquery_matchxdr_ctxstatusNETUTDM_dm_set_dmattrungetcstart_lgtomapperset_nonprivilegedi18n_day_hmshmgetxdr_pb_mdk_type_tfind_nsrindexdiruca_typecc_t_needs_initattr_typecheckca_ntattr_funcset_immediate_buf__lgto_svcerr_progversasm_fullpath_funcxdr_times_tfile_li_get_fileidmif_t_needs_initval_dupnsr_resdb_query_countclntmm_clonestart_5Rawasmnamesscanfxdrrec_outputbufemptyfind_nsrtmpdirnsr_info2attrsgetIgnorxdr_lgtosvc_parmspb_snapshotxdr_RM_SESSION_argslcaselg_ts_gethostentrpc_closehand_server_statisticsxdr_nsrnamelist_bsearchasdf_write_sectionxdr_mmdb_statusclntmmdb_fetchss_range_5lg_ts_randxdr_volid_tPosixCRCasmnamexdr_uint64_tasm_open_recover_handle_funcrawasm_saveNETUTDM_dm_handle_cmplnm_error_set_ascii_msgNETUTDM_dm_respond_eventutf8_mbtowcstat_set_stdev_funcType_info_cache_timeoutxdr_nunixfileentryadd_ssid_sortedfile_cmp_stdevxdr_short_volid_tsha_to_stringnsr_rstartnsr_dirsepprint_pbobj_listmm_chunkNSR_MOVES_DOUBLESxdr_MM_CHUNK_argsBigasm_checkallx_debug_setup_nsr_strerrorsetgidNETUTDM_dm_getall_dmattrnotsupported_controlmm_sstartnwora_sbt_clean_errmsgrap_haslocres_dup2xdr_errstringxdr_wrapclntrec_nsr_strdupnsr_resdb_openclntrm_recover_need_old_2ssncommon_init_ssnclntrm_monitor_device_done_2lg_wfgetsclntmm_mark64_5xdr_rlist32_tclntmm_check_fs_5sbtinfoval_cmp_exactresdb_dirisave_setupset_curr_mm_versnworapc_sess_get_object_by_nameclu_pathl_getmountsxdr_nunixfileidobjectlistp_cmplnm_get_client_attrslgto_parmsDefault_asmidsvc_dummy1Asm_charobjelem_freesvc_dummy2verify_attributesset_AvoidFidsinitpspasdf_countca_set_direntry_funcasm_replace_fakeroot_funcasm_mkdirpath_funcsbtpc_object_sbtpcbackupclntmmdb_asm_data_5lg_getdomainnameDefault_handler_listxdr_nsr_keyxdr_residlistnwora_set_resourcefind_nsrcoresdirset_resfile_cache_namexdrrec_splice2comp_u_longis_mountedvallist_deletereshand_callis_pre7_nwadminmember_of_groupisupperstring_residfind_nsrlogsdir__lgto_authsys_create_defaultnsr_p_initca_lgattr_funccv_decompresslg_thr_initdxdr_RM_RECOVER_NEED_argsget_valid_pooluca_is_backup_apiindex_purgelist_freexdr_vol5_rsltrap_op_to_strTrace_file_namecs_checkNETUTDM_dm_get_fs_flagssvc_reinit_access_rightsclntnsr_rstart64_2xdr_nwbsa_objectinfo_tindex_flushclu_is_cluster_modeNETUTDM_dm_set_dispinitdapnote_file_stdoutbsearch_array_initfind_nsrraplogfile__lgto_xdr_bytes_GLOBAL_OFFSET_TABLE_parse_network_entryxdr_svc_decode_clntcreddf_time_cachedrpcport_cleanupsave_fileasdf_recover_mpe_metadataxdr_rm_typesNETUTDM_dm_release_rightxdr_select_vol_infonwora_env_read_parameter_filenote_emitter_done_stdoutxdrfr_refillstatattr_alloc_funcfile_get_stisdirvolid_to_volid5getXflgmmdb_hintfile_get_stblksizeclntrapproc_retrieve_3lnm_logger_createmmdb_deactivatecreate_msgssn_envstringsbtwritesbtclosegetuidstrtok_rSet_atimeres_printgetSufxerr_settypexdr_RM_INDX_SETINFO_argsxdr_rlist_txdr_rm_monitor_device_shortxdr_nsrfx_stypecredchecklgui_is_notidclearerrhlink_create_funcasm_pslookupnwora_get_sbt_versionhandlist_freeNETUTDM_dm_get_trace_levelDbgcmdpathattrlist_legalLG_FD_ZEROxdr_mm_typesca_fsid_funcasdf_read_sectionuca_set_lgattrxdr_vol5_tsigfillsetnwora_toupperclntnsr_start_pools_2hand_limitstringstart_mm_rap_opmmdb_set_client_id_mappropagate_attribute_updateGlobal_rpc_p_varpget_companion_volnameuca_set_ntattrprotoresetxdr_NSRFX_END_6_argsget_oracle_parmssbtpc_object_post_pb_saveclntmmdb_get_client_id_map_6xdr_sc_impl_tasdf_recover_pw1asm_passwordLG_FD_CLRlgto_otg_hsm_stub_recoverlnm_buffer_splitresidlist_mergelg_readdirlgclosexdr_dospathli_get_next_addr_funcnworapc_sess_open_restoresigactionattrlist_case_findhsm_count_funci18n_fmsgdefault_verifyAsmnameclntnsr_end_2svrc_initxdr_nsrfx5_timesNETUTDM_dm_set_fs_flagsNETUTDM_dm_handle_hashisnewasmsscontgetpwuid_rinet_makeaddri18n_nsrvalget_rpc_svc_t_varpsbtinitfile_get_stisencryptedxdr_PBCS_CANCEL_args__majorclose_consoleresidlist_freeInitted_cv_hashtabasdf_recover_ptx_aclsbtinit2ca_is_backup_api_func__iobxdr_MMDB_FETCHSS_ID6_argsAsminheritset_authlgto_calloutreally_get_stinoyp_get_default_domainxdrcount_createasm_fstat_func__lgto_xdr_u_longlg_get_installdirattrhand_setxdr_ichunk_txdr_ssr5_rslti18n_3getMapfrommmdb_set_query_onlymm_bufferdonesetuidnde_name_funcsbtremove2get_ss_bytimeclntrm_monitor_device_fail_async_2utf8encodeindex_hintlnm_buffer_addlnm_logger_plain_text_msgpthread_mutex_lockasdf_xlate_wrapis_local_rootget_myaddrssr_clr_to_opqclntmm_mark_5volid5_to_volid__lgto_xdrrec_skiprecordpathconfxdr_MM_CRSTART_A_argsxdr_lgtononce_replyca_hardlink_path_funcpoll_mm_rap_opAsm_parseasdf_output_sectionIgnorenameunix_recoverSkip_dir_saves__lgto_clnt_perrorlocal_bsearchlg_cond_createsha_finalgetusernamexdr_pb_type_tssncommon_do_callbacklnm_index_cfx_lookupnwora_spawn_and_waitfind_ssGlobal_rpc_t_varpobjectlist_removeset_xmalloc_failedsf_startclntmm_write_label_5mm_retrieve_rs_infoutdmapi_global_handle_ptruser_has_privilegeMax_mswaitnwora_sbt_do_info2is_in_userlistenum_hostsmc_facility_idnsrports_get_svc_portsstat_set_stblocks_funclg_lckflmc_message_idclntmm_direct_file_precommit_5vallist_pos_insertlgto_password_digestclntnsr_retrieve_2lg_cond_destroyFiles_traversed_per_time_callsvc_set_destroy_callbackNETUTDM_dm_remove_dmattrNETUTDM_dm_getall_dispmdb_cache_setsizensrrm_errorfree_idsclntrm_label_fail_async_2lnm_logger_inituca_has_fileidrap_volume_operationclntpbcs_environment_1default_countDebug__lgto_clnt_perrnosvc_invalidateispathrelativehsm_fini_save_funcset_rap_srv_keyclntmmdb_fetchss_time6_6nwora_delete_filexdr_s2u_shortenmm_free_handledefault_saveextern_savexdr_RM_LABEL_DONE_OLD_argshashstrUse_direct_file__lgto_pmap_rmtcallresfile_freexdr_RM_PROGRESS_argsxdr_rap_statusfile_get_stinoxdr_saveerrsxdr_NSRFX_FLUSH_argsnwora_paths_are_equalrpc_t_cleanxdr_ctxstart_poolsres_new__lgto_clntudp_createclu_is_pathl_createdis_in_lg_time_arrayca_set_is_reg_funcxdr_handoff_cmdindex_setquerygetpwnam_rclntpbcs_save_1is_recycle_to_other_poolslg_varp_destroy_idDebug_mevallist_count_valxdr_dosfilename20filter_special_volslg_set_argv0hand_retrvcreate_msgssn_fdNETUTDM_dm_destroy_session__lgto_svc_getreqget_rqr_priv_portssbtpc_object_finalize_metadatares_parsebufsigemptysetxdr_MM_RECOVER_SPACE_argsnworapc_sess_open_backupis_in_lgui_arraysha_updategetfstablg_lstatmm_iclone_setupmm_check_fsclntrm_monitor_device_done_old_2pb_cancelx_debug_statsclus_get_vfstabsresidlist_intersectxdr_errinfoxdr_MM_SETUP_CLONE_SAVE_SESSION_argsNETUTDM_dm_get_regiondir_io_direntry_get_filename_funcasm_t_cleannsrrm_devopssncommon_get_unique_idgettimeofdaysvrc_stat_funcclntlgto_parms_old_3dosdcl_decodenwora_find_nsrtmpclntmm_read_label_5ca_alloc_funcclntmmdb_fetchvol_barcode_5am_i_a_snodeclntpbcs_snapshot_1lnm_stream_file_restore_initclntmm_setup_clone_save_session_5lnm_index_createsvc_time_resetNETUTDM_dm_get_parent_handlestrcspnxdr_ss5_lstclntrm_recover_need_2xdr_vol_rslt__minorclntrapproc_create_3levelsfilter_sync_bitsfree_spawn_user_contextxdr_imm_recitemclntmmdb_delete_ss_5nwora_common_metadatansr_attr_unpackasm_chown_funclgsononblockdxuldm_recoverfilefetchvol_poollg_closenstdfilesAsm_lvalset_xprt_register_fcnnwora_res_file_exists__lgto_xdr_pointerNETUTDM_dm_set_eventlistfree_asmportxdr_fileList_tresdb_calloutxdrfrr2_create__lgto_xdr_doubleitoitypepthread_cond_initsvc_getreqset_varped_dbgclntnsr_rstart32_64getMaptolenpreflenrefresh_choicesxdr_pbcs_inquiryNETUTDM_dm_get_session_flagsxdr_retrieve_replyxdr_PBCS_ENVIRONMENT_argsfile_get_stmtimeis_snapsetfgets_memxdr_MM_DIRECT_FILE_MORE_ROOM_argspb_preparesvc_timeUse_directnwora_get_metadataxdr_asmrecval_stradd_pamp_to_envxdr_chunk_tfind_volxdr_nsrfx_timesfile_set_stinois_unc_pathnworapc_object_id_generateclntmmdb_fetchvol_name_5lg_userlist_parselg_get_bindirclntrm_monitor_device_fail_2getShortnamesEnabledget_cc_t_varpresid_stringis_arraymemclntmm_chunk64_5createdirentrynworapc_sess_add_pb_object_tclntnsrfx_end_6_6xdr_ssr_rsltuca_gidxdr_NSRFX_START_6_argsget_filesizeerr_move_to_varpvallist_cmpconflict_promptxdr_app_metadata_tsetdirsepclntrm_label_done_2read_sockNo_mem_errasdf_unwrap_sectionmerge_vol_ssidssetreuid__lgto_xdrrec_endofrecordqueryhand_typeslg_get_libdirdisable_cacheable_pmaplnm_stream_closedefhand_initstrrchrxdr_RM_LABEL_FAIL_argsregevent_setupxdr_mm_op__lgto_xdr_pmapgetOrigMnt__lgto_bindresvportpthread_getspecificseteuidxdr_nwbsa_copyid_sxdr_LGTO_PARMS_argsxdr_nwbsa_copyid_tlg_thr_waitclntnsr_volumes32_2xdr_rm_actionNullfuncasm_conserve_fds_funcresnum_cmpclntmm_chunk_5xdr_nwbsa_lgname_tclntmmdb_new_volume6_6Dfr_buf_szpath_concatpthread_attr_inituca_getis_jb_devicerm_broker_updatefile_get_stsizei18n_nsrattrxdr_NSRFX_START_argslibsocket.so.1SUNW_0.7libnsl.so.1SUNWprivate_1.1libdl.so.1libpthread.so.1SUNW_1.2libgen.so.1libkvm.so.1libelf.so.1libadm.so.1librt.so.1/usr/local/lib:/usr/lib:/lib:/usr/share/lib =(*30 =(* Nq?O =(*Z ='j$`$$$$$$$$$ $(0$0H$8P$@$H$P0$X8$`$h`$p$x$$8$$X$x$$$$x$$$`$@$$$$$$$$ $( $0@$8X$@ $H$Pp$Xˆ$`$h$p$x$$($H$Ø$X$ø$$$$($0$@$P$ $$$$$0$@$ X$(0$0h$8$@($Hp$P8$XP$`($hX$px$xŸ$$Ř$$X$ $p$$x$ɠ$P$ǘ$ǰ$Ȉ$$0$H$$$$$ $($0$8$@8$H`$Pp$XȐ$`Ƞ$hȰ$p`$xx$ʨ$$$$H$p$ˈ$˨$ˠ$˰$$$$$$$ $8$H$X$ h$(x$0̈$8̘$@̨$H̸$P$X$`$h$pͰ$xp$0$0$H$p$Έ$Θ$$$$($Ϡ$x$P$$и$А$X$ $$$ $(Ѹ$0$8X$@0$H`$P0$X$`x$hĠ$p$x$$$Ƙ$$$$ $8$H$X$h$x$Ӑ$Ө$$$$$$($ @$(P$0h$8h$@$H $PԨ$X$`հ$h$p$x$ $$x$H$p$֠$$$$$($@$ט$$$8$נ$`$H$P$ p$(ؘ$0ظ$8$@$H`$P$X$`($h8$p@$xP$h$x$٠$H$ۀ$8$ $$$$`$$ڸ$@$ژ$۠$p$۸$$H$ ($(ܘ$0ܰ$8$@$H$P($X8$`H$hX$ph$xҀ$Ҙ$Ұ$$$ $h$$($0$ $@$8$H$$`$x$$޸$0$h$ p$(ݨ$0$8$@$H߰$PX$X߈$`8$h$p$x$$ݸ$($H$h$$$$$$$P$8$ $H$$$$$$ $(h$08$8$@$H$P$X@$`$h$p$x $$H$$$$$$$$($@$x$$($X$$H$$$$ $($08$8p$@$H$P$X$`$hH$p$x$$$$H$$ $0$H$X$h$$$$$0$$$$P$$ $($0h$8$@0$H`$P$X$`P$h$p$x$$($x$p$H$$$8$$$$ $$$$H$P$$$0$ $($0p$8$@$H$PP$X0$`$h($pP$x$$`$$8$$P$$$0$H$`$$$$$$$$0$X$ $($0$8$@$H$P$X$`$h8$p`$xh$x$$$$$$$$($8$X$$p$$$$h$8$$$ $($0$8H$@$H$P8$X$`$hP$pp$x$$P$h$$$$$$$$8$$$$($$h$P$`$$ 8$($0$8$@P$H$P$Xp$`$h$p$x0$($@$H$`$$$$$P$($$$$($0$`$$$$8$ 8$($0$8X$@$H$P$X0$`@$h $p$x$$0$$X$ $ $ $ x$ H$ $ $ 8$ H$ $ $ p$ P$ $ x$ $  $( p$0 H$8 $@$H $P $X x$`P$h H$p $x $h$$$$$$$$$$%$@$H$h$$$$$%`$% $ %$(`$0$8$@$H$P$X$`$h$p8$x%$%$%$%$$$$$$$$0$P$$$@$p$$$$p$ $($0$80$@$H$P$XX$`p$h$p$x$$$$$@$0$8$P$p$$`$$$$$$$$$$ $(@$0$8P$@$Hp$P$X$`$h@$p$x($p$$$$$$ $8$H$`$$$$0$@$`$$p$8$$ $(X$0$8$@ $HP$Ph$X$`$h$p$x$$h$$$($p$$`$$$$$H$`$$$$$ $X$ $($0$8$@$H$P $X p$` $h P$p $x $ $ $!h$!H$!$!$!$!$"$"$"($"X$"$"$"$#$# $#8$$$ $($0$8$@8$H$PH$Xx$`%$h#X$p#h$x#$$ $#$#$#$$P$$`$&`$'$'$($(($($($(X$(8$($($)$)$)($ )$()P$0)x$8)$@*$H*$P)$X*X$`*h$h*0$p*@$x*$*$+$+$+$+X$+($+$+$+$,$,$,0$,H$,`$,x$,$,$,$,$-($ -$(,$0-X$8-$@-p$H-$P.($X.@$`.$h.$p.$x.$/$/H$.$.$/$/ $/$0$0X$0x$0$0$1X$0$1$1$1$$$$$$$ %$('$0%0$8%8$@'`$H'X$P%h$X3$`3$h4P$p4$x40$4$4$4$4$5$5$5$4$6$6($6P$6$6x$6h$6$6$7$8$7$7($ 78$(7H$07P$87`$@7p$H7$P7$X7$`7$h7$p7$x7$8$8 $80$8@$8P$8`$8p$8$8$8$8$8$9$8$9($9H$9$9`$:$:h$ :8$(2H$02`$82$@3P$H3($P2$X2$`3$h3$p3$x;($;8$;H$;P$;h$;x$;$;$;$;$;$;$;$:$:$:$:$;$;$:$:$ ;$(;$0<$8<$@<$H<$P<$X<$`=$h<$p=$x=($=H$=$=$=`$<$<$<$0$>P$>$>$>$?$?($?@$%$E $E8$EH$EP$%y($F$F$F$G$G$G$ G$(GP$0G$8G$@G$HH$PH$XHP$`E`$hEx$pE$xE$F$F@$F`$FH$F$I$I$J$J@$J $J`$J$J$J$K$K8$K$H$H$H$ H$(I$0IX$8I8$@Ix$HI$PI$XLH$`L$hL$pM$xM0$MP$Mx$M$M$O$M$N$N($N@$NP$Nh$O$N$N$N$N$N$N$O$Oh$ P$(S$0S$8P0$@P@$HP$PR$XP$`R$hP$pQ$xP$Q$P$S$T$T$T$Tx$TH$T$U$U0$U`$U$U$Ux$V$V($W$VH$V$ V$(W$0W$8W@$@WH$HWx$PW$XX$`X8$hX$pX@$xX$Z$X$X$Y$Y $Y$YP$Y$Y$Y$Y$Z@$\$[$[@$[h$[$[$Z$Z$ [$(Z$0Z$8ZX$@\0$H\H$P\p$X\$`\$h\$p]$xb$b$b`$b$b$b $b$cx$cP$c $`($`H$`h$`$`$`$a$a`$a$a$_$ ^$(^p$0^$8^$@_x$H_$P_$X`$`_$h]0$p]$x]$]h$]$^$^8$^X$_P$_($b$c$c$c$KP$K`$Kp$K$K$K$K$L $L$ L$(c$0e$8e$@f$Hf $Pfp$Xf8$`f$hf$pf$xg$g$gH$g$g$g$h$h$h$c$e$ex$e@$d$e$d$dx$d8$d$i$i$ i$(i@$0iX$8jH$@jp$Hjh$Pj$Xj$`j$hj$pj$xj$h@$hP$hx$h$h$i$j($j$i $%b$%b$lh$l$l$l$l$l$m$m$m$ m0$(mH$0m`$8mx$@m$Hm$Pm$Xm$`n$hn$pkp$xkx$€l $ˆk$k$˜k$ l$¨k$°l8$¸lP$%y8$%$|$o$o$o $o8$oP$oh$n$n0$np$ n$(n$0n$8n$@n$Hn$Pn$X%$`o$ho$pp@$xpP$Àp`$Èpx$Ðp$Øp$àp$èp$ðo$øop$ox$o$o$o$q$o$q$p$p$%b$r$s $ t$(s$0s$8s($@s`$Hs$Pt$Xt`$`t8$ht$pt$xu$Āu@$ĈuX$Đ%$Ęq$Ġq@$ĨqX$İq$ĸq$r$q$rP$r0$r$up$vx$v`$v8$v$v$u$ u$(v$0wh$8wx$@{8$H{h$Pz$X{$`z0$hy$pz$xy$ŀz$ňzh$Őw$Řw$Šy$Ũyh$Űw$Ÿx$y$yX$x$w$xp$xX$x8$x$x ${${${$ {$(|8$0|@$8|`$@|x$H|$P}8$X}0$`}$h|$p|$x}P$ƀ}h$ƈ}p$Ɛ}$Ƙ}$Ơ}$ƨ}$ư~$Ƹ~8$~$~H$P$ $$~$~$~$%t$%b$u$w$ wH$(v$0v$8v$@u$Hv$Pu$Xv$`%h$h%l$p@$xH$ǀP$Ljh$ǐ$ǘ$Ǡ$Ǩ$ǰ$Ǹ$$$$8$$$$%$H$$%8$%H$ 0$(h$0p$8$@$H$P$X$`$h`$px$x8$Ȁ%y$Ȉ$Ȑ$Ș$Ƞ $Ȩ@$Ȱ $ȸX$$$$$$$$h$%$%c$`$$ $($0@$8$@P$HH$PP$X\$`%$h%$p$x%$ɀh$Ɉ$ɐ$ɘ߬$ɠX$ɨߴ$ɰt$ɸߤ$$$ݘ$ߜ$߄$ݨ$$ި$ߔ$$$$$ $(H$04$8ݸ$@ވ$HX$P$X$`$h$p$x0$ʀ$ʈ|$ʐh$ʘ$ʠ$ʨP$ʰ$ʸ$d$$%$$$\$@$p$$$8$X$ x$($0$8$@$H($P$X$`8$h@$pP$x$ˀ$ˈ$ː$˘$ˠ$˨$˰`$˸8$$$$$x$P$($$$$ $$ P$($0$8$@$H`$P8$X$`$h$p$xp$̀@$̈$̐$̘$̠h$̨8$̰$̸H$$$$$$ $$$@$$H$$ x$($0$8P$@%$H%$P%$X$`$h$p%z($x+h$̀+\$͈$͐H$͘$͠+t$ͨ`$Ͱ8$͸$$$X$$$$$P$$h$$$ x$(X$0$80$@$H$P$X$`$h$p $x$΀$Έ$ΐ$Θ8$ΠP$Ψ$ΰ$θ$%T$$$$`$$$$H$p$$ $  $($0$8$@p$H8$Ph$X@$`$h$p8$x`$π$ψ$ϐ$Ϙx$Ϡ$ϨH$ϰ`$ϸ$$($p$$$H$$$H$ $$$ $($0%X$8%\$@($Hp$PP$XH$`0$h$p$x$Ѐ$Ј$АP$И($Р$Ш$а$иP$p$8$$$$$%`$$$$$$ $(H$0$8$@$H$P$Xh$`$h$p$x$рx$ш $ѐH$ј$Ѡ$Ѩ$Ѱ$Ѹ$$$$$P$8$p$$$$%zL$%zP$ X$(0$0$8$@$H$P% $X$`%$h$p$x$Ҁ$҈$Ґ`$Ҙ $Ҡ@$Ҩ$Ұx$Ҹ$H$8$X$$$$$$$$8$`$ 0$($0$8x$@$H$P$Xh$`$h$p8$x@$ӀX$ӈp$ӐP$Ә$Ӡ$Ө$Ӱ%z`$Ӹ%zX$%zp$$$$$ $0$`$x$$$0$ $($0$8%zh$@%$H$P$XL$`$h$p$x$Ԁ8$Ԉh$Ԑ$Ԙ$Ԡ$Ԩ%$԰%$Ը%$%$0$$($$P$$$$h$$%z$  $($0$80$@H$H$Ph$X$`%($hx$p$x$Հ$Ո$Ր$՘P$ՠX$ը`$հh$ոp$@$$$$@$$h$$0$$H$$ p$($0`$8$@$H$P$Xx$`H$h0$p$x$ր$ֈ8$֐$֘$֠X$֨x$ְP$ָ $$$$$$$%z$%z$%$$$$ $($0$8$@$H$P$X%H$`%$h%$p%P$x%D$׀%8$׈%z$א%z$ט%X$נ8$ר $װ$׸$$$$$$$X$%c8$$$$$ %`$(($00$88$@@$HH$PP$X$`X$hp$px$x%h$؀p$؈$ؐ $ؘ$ؠ$ب8$ذP$ظ`$$P$($$$$P$p$x$%t$$$ $($0$8%p$@$H$P$X$``$h@$p$xp$ـP$و$ِ%z$٘%z$٠%@$٨P$ٰ`$ٸÀ$Ø$è$$Ĉ$$$0$H$ð$X$p$Ę$ İ$($0$8$@$H$P0$XP$`p$h$pŀ$xŘ$ڀ$ڈ$ڐp$ژ$ڠp$ڨ$ڰ8$ڸ $x$`$x$ƈ$$$ǀ$8$$H$Ǩ$$ $(Ǹ$0$88$@H$H$P$X%H$`%P$h$p$x$ۀ°$ۈ¸$ې$ۘ$۠$ۨ$۰0$۸%8$%@$%($%0$% $ɠ$ɨ$$x$H$`$@$ʈ$ ʐ$(ʠ$0ʸ$8$@$H$P$X$`$h$p $x%X$܀$܈$ܐ$ܘ$ܠ$ܨ$ܰ$ܸ $0$X$ 0$%`$$$ $@$P$x$̘$̠$ $($0$8 $@$H$P0$X`$`͈$hͰ$p$x%h$݀0$݈%c@$ݐ%dP$ݘ0$ݠ$ݨ@$ݰh$ݸ $%π$%x$%ψ$%ό$$($P$X$p$`$π$ϐ$ Ϡ$(ϰ$0$8$@$HP$P8$XИ$`Ш$h$p$x$ހ$ވh$ސ($ޘH$ޠ$ި8$ް`$޸x$р$ш$ј$Ѡ$Ѱ$$$Έ$ΐ$Π$θ$ΰ$ $($0$8$@$H$P($X$`P$hӀ$pӨ$x$߀h$߈$ߐ$ߘH$ߠ԰$ߨԐ$߰$߸ $$p$H$ $հ$$֘$x$P$$$$ װ$(׈$0X$80$@Ҙ$HX$P$X$`@$hp$p@$x$$$%ϔ$%Ϙ$%ϐ$٨$$$($ژ$p$ڸ$$$0$P$ې$۰$$$ P$(x$0$8܈$@ܘ$Hܠ$Pܨ$X$`$h$p0$x8$x$݈$ݘ$ݨ$%z$ݸ$$x$$ذ$ب$$0$h$و$ 4$%Ϡ$%ϰ$$%Ϩ$ %ϲ$($0$8$@$H8$P`$XX$`߀$hߠ$p$x$$$$H$$$$$8$H$%z$ $ $$%ϸ$$@$h$x$$$ $($0ް$8ވ$@%$H St$P R$X V$` S$$h R$pH$xx$$ Q$ V$ SP$ W$ R$ WT$%8$%$8$H$X$`$h$p$x$$$$$ $($0$8$@%x$H%Р$P%А$X%$`%и$h%P$p%$x%Ј$%а$%H$%Ѐ$%0$%p$$$$$$$$ $($0$%И$%$%`$%$%($ %X$(%@$0%Ш$8%h$@%$H$P$X$`0$hh$p`$x$$ $$X$@$8$P$`$$$$$$$$$$$$$ $( $0H$8$@$H@$P$X$`h$hx$p$x$$@$H$P$h$$p$%{H$%$ 0$ $$h$$$$$$$$ $(%$0%$8($@$H$P$X$`$h$p$x8$P$`$h$p$%8$%@$% $$$$ $8$H$`$$p$x$%$%0$%($ %{\$($0$80$@$H$P$X$`$h$p$x$ $0$@$P$X$`$p$$$$$$$$$$$$ $0$ 8$(@$0H$8X$@$H$P$X$`$h$p$x$$$$$($8$@$$H$$X$$h$$x$$$$$$ $(p$0$8h$@$H$P`$X$`H$h$p@$x$0$$($$$$$$ $0$$@$P$$p$ $$$$$ p$($0P$8$@($H $P$X$`$h$p$x$0$8$H$$$$$$ $H$X$`$x$%H$%0$X$`$h$$x$ $(%$0%H$8$@$H%8$P$X8$`$h8$p$x($$h$X$h$$$$$ $$$@$ $`$$$$$$$ $($0$88$@P$Hh$P$X($`p$h$p H$x I0$ I$ Id$$$$$$$$$$$8$ $$$$ $0$@$ P$(h$0$8$@%X$H%P$P$X$`$h$pH$x$ n$%{$P$$$$$($X$$p$$%{$%h$%d$%p$ ~$%`$%{$$ $($08$8`$@%t$H$P$X0$`H$h$p$x$$X$$$p$$$X$$$$h$$$H$$$$x$$ $(H$0P$8@$@$H$P$X0$` $h$p$x$`$$$$$$$$$$$8$$X$h$$%d$($0$@$ P$(p$0$8$@$H$P$X%|$`$h$p$x$($$$%׀$$$$$$$$$$$P$$$h$$$ $($0$8$@$H$P $X $` $h $p 0$x H$ X$ `$ p$ $ $ $ $ $ $ $ $ $ $ $ $ $ $ 0$ 8$ @$  P$( X$0 h$8 p$@ $H $P $X $` $h $p $x $ $ $ $ $ $ $ $ $ $ $ $ ($ 0$ 8$ @$ P$ X$ `$ p$ x$  $( $0 $8 $@ $HH$PX$Xp$`$h$p$x$$$`$ $ $ $ $ $ $ $ H$ $ $ $ $ $ $ $ $$ ($(@$0H$8p$@`$Hh$P ($X H$` P$h $p $x $ $ $ $ @$h$X$P$H$@$8$($ $$$$$$$$$ $($0$8$@ $H0$P@$X8$`h$h$p$x$p$$$$$$$$$$$x$p$$$$($$$$ $(X$0$8p$@$H$P$X@$`p$h$p$x$$$$`$X$h$$$%$%א$%$%ט$%$$$0$$$@$p$ X$($0$8%$@%$H%$P$X$`h$hp$p0$x@$H$$$$$$`$P$p$x$$$$$$H$8$P$$$ $($0$8$@($H0$Ph$X$`x$h$p8$x@$H$$$$%eP$X$$$$$$$$$ $`$%eh$$$$ $(8$0P$8$@h$Hp$Px$X$`$h $p $xh$$$$$$$$$$%ep$%$$X$($%$8$P$x$$$ $($0$8$@$H%{$P x$X%e$` $h$p$x$%$ P$ p$$$@$`$$ $$$$ ($%f0$h$ $$%$"$$$ $$(%$0%$8%$@% $H%0$P%8$X%@$`%P$h%`$p%h$x%$%$%$%$%$%$%$&P$&X$&$&$'$'$'$'$($( $(8$(@$(h$(X$ (`$(($0($8($@($H($P($X($`'8$h'p$p'x$x'$)$)$%$%$"4$%$%ܸ$%$%ܨ$%ܰ$#v$%$%x$$$#$#$$p$$$$$$$ $$($$0$$8"$@%$H $P"$X%܀$`%܈$h%ܐ$p%p$x%x$%ܘ$%h$!$" $%$%ܠ$%$%$%x$"$)$)$)$*$* $*($*P$*p$*x$*$ +$(+$0+$8+p$@+X$H-`$P,p$X+$`,$h,$p+$x,8$,$,$,$-$,x$- $-8$,$-$-P$,$%$N$)x$)@$)X%)H%) %)0%)h% )%()%0)%8.0%@.H%H.@%P-h%X-%`-%h-%p-%x-%-%-%.%.%.X%.%.%%f%%f%%%n%%g%.%/(%/%/%/%/%/%/X% /0%(0`%00h%80%@0%H0%P0%X0%`1%h10%p/%x00%/%/%/%/%0%08%0P%0X%2%2p%38%3%3`%3%%݄%%P%1P%1%1% 1%(1h%01%81%@2H%H2%P2h%X%g8%`%{%h%{%p%݈%x%݀%%3%%gh%%݌%%|%4%%{%%g%%ݐ%%{%%ݠ%5%4%4(%4%4%4P%4p%%|%% L%(%%0h%85h%@5H%H58%P5%X5P%`5%h5%p%%x,%%ݨ%%%%%H%%ݸ%%%ݰ%%g%5%5%%|%6%7%7%5%6h%6%5%6%68% 6%(6%06%87%@7 %H7X%P8@%X8p%`7%h7%p8(%x7`%7%8%8%:%:%:@%%:%:%;%;%; %;%;%%g%%%%%}%8%9% 9%(9P%090%89%@9%H:%P:%X:H%`%%h"%p%%x%%0%>@%>H%>P%>% >X%(>%0%(%8>h%@>%H>%P>%X>%`>%h?%p?%x? %?(%%0%=8%=P%=`%=h%=x%=%=%=%>%=%%}%%}(%%D%%}8%%}D%%}@%M%M% %h%(%H%0%}<%8%i %@h%He%P{%X?0%`?`%h?%p?%x@%@%@@%A%eP%%i%%}P%L%{,%%}H%%P%%}T%{`%|8%%}L%%j%%X%%`%%d%A8%AH% AX%(A`%0Ax%8%h%@%l%HD@%PC%XDx%`A%hA%pB%xB0%B`%C%B%C0%DP%D8%%}%%p%D%D%%}%D%Ex%E%%j%E% F% GH% G% G% H(% (% 0%ހ% 8%}% @%x% HHP% P% X% `H% hH% pH% xI0% IX% I% I% J0% J% J% %ވ% %k(% KH% K8% K`% KP% KX% Kh% Kx% Kp% %ޠ% %ސ% %ޘ% H% K% (K% 0K% 8K% @K% HK% PK% XK% `K% hK% p%ި% xK% K% K% %% %@% %k% %}% %}% K% L% LH% L% L % L(% N% N % N(% N0% N@% NH% NP% NX% (N% 0M% 8M% @N% HM% PM% XM% `M% hM% pM0% xMH% MP% MX% M`% Mh% Mp% Mx% M% M% M% M% %% %% Lh% Lp% M% L% L% L% L% L% M% (M% 0%% 8%% @%% H%% P%% X8% `8x% hC,% p%}% x8p% %~`% C+% %}% A% 8% 8% 8% 8t% N`% Np% Nx% C,% C,% %~l% %k% N% N% N% N% N% %% (T% 0T% 8T% @T% HT% PU% XU(% `U8% hUH% pUh% xU% U% U% U% U% V% V% V8% VX% Vh% V% V% V% N% PP% Pp% P%P%QH%QX%Qx% Q%(Q%0Q%8Q%@R%HR %PR0%XRH%`R`%hR%pR%xR%R%R%R%S %S@%SX%S%S%N%N%O%O%O%O %O(%O8%O%O%O%O% OH%(Op%0Ox%8O`%@OP%HO%PP%XP8%`P(%hPH%p%%xC,%C,0%S%S%S%S%S%T%T(%T@%TX%Tx%C, %%%C-8%Wx%W%W%W%W%X% X(%(C-@%0%k%8C-H%@XH%HXX%PX`%XXh%`%l%h%l%pY%xY%Z0%Y%C-P%Z%Z%Z%[0%[%Z%ZH%Z%Yx%Y%C=T%C=p%[%[%[%[`%C=X% C=\%(C=x%0C=P%8C=%@%r%H^\%P%u%XC=%`C=%hC=%p]%x%sX%C=%%m%C>%%n%e%ex%e%%%C=%C=%C=%_%C=%C=%`%`%_%C=%C=%C>% [%(C=%0^%8C=%@C=%HC=%PC=%XC>%`C=%hC=%pC=%x\%]b%C=%C=%C=%C=%C=%^p%C> %C>%C?`%e%e%e%e%f(%f%f@%C? %C?(%fp% f%(f%0f%8f%@f%Hf%Ph%Xh%`h%hi%pi0%xiP%ix%i%i%i%i%i%i%i%i%j%j%j %j8%jh%j%g%g8%gX%gx%g% g%(g%0h%8h8%@h`%HC?%PC?%XC?%`C?%hC@%p%w(%xk%k%C?%C@%CE%CEH%n%o%k%k%k%l %lP%l%nx%nP%l%l%m%mx%mH% m%(m%0m`%8m%@m0%Hm%Pn%Xn%`n(%hCEP%pCE %xCE@%CE(%k(%k%k0%k`%kp%k%n%n%n%CE,%%%%%CE0%CE4%CE8%%w0%%%CW%p% p%(p@%0ph%8p%@p%Hp%Pp%Xq%`q%hq(%pq`%xq0%q%rx%q%r`%rH%r %r%CE`%CW%r%r%s%s`%r%s%s(%{%z%w(%{% z%(z%0z%8z%@z%Ht%Ps%Xs%`s%hs%ps%xs%tp%t@%t%t%t%t%t%u %u(%uH%up%u%u%u%u%v%v@%vp%v%v% v%(x%0w%8w %@xh%HxH%Pw%XCEp%`w%hw%pw`%xw%w0%w%x%w%x%wH%wP%x %x%x%y%yH%yh%yx%y%CX%y%z%z(%z@% CFx%(CEh%0o(%8oH%@zh%Ho%Po%Xo%`o%ho%pp%xp %CF%CG%CG%CG%CEx%CW%CEX%%%{%{%{%{%|x%|p%{%| %{%CX%CX%%w8% CX%(%%0CY%8CY%@CY%H|%P|%XCY%`%%h~%p%x %0%8%%%%%%%%}%~%~8%~x%CY%%%%wh%CY%H%`%h%p%%x% %(CY$%0CY %8m<%@CYX%HCYP%P%X%`%hCY%pCZ%x%CZ%%H%%%%Cj%%%0%X%P%X%`%x%p%%%%% %(Cj%0Cj%8Cj%@Cj%Hp%P %X%`%h%p%x%%%%%%8%(%h%%%Cj%%w%x%%%%%X%%% %(Cj%0%w%8%w%@H%H`%Ph%Xp%`Cj%hCmP%pCo%xCr%%%%%%%% %(%0%Cj%Cj%Ct`%Cv%% %(%8%@%H% %(`%0x%8%@%H%P %X0%`X%hx%p%x %xx%Cy%C%x%%(%%%%%%%8%H%X%h%x%%%%% %(%0%8%@%H%P%X%`0%hX%px%xC %C%Cp%C%%%%Ch%C%%%֜%X%%%x%% % % % % % ( % 0C% 8C% @% H% P% X% `% h% % pC% xC% C% % % %  % (% 8% @% P% X% `% h% %% %% % p%!x%!%!%!%! C%!(%!0%!8 %!@%!H%!P%!XC%!` %!h %!pC %!xC%!%%!%%!C%!%%!C0%!C(%!%!%y %!0%!%!@%!H%!%!%!%!%"(%"8%"%"%" %"(%"0%"8X%"@`%"Hh%"Pp%"Xx%"`%"h%"p%"x%"%"%"%"%"%"%"(%"8%"p%"P%"X%"0%"`%"(%"0%"8%#@%#H%#P%#X%# h%#(p%#0x%#8%#@%#H%#P%#X%#`%#h%#p%#x%#%# %#(%#H%#CH%#%#%#%#%#%#%#%#%#%#%#%T%$%p%$%`%$CH%$%d%$ %X%$(CH%$0%h%$8p%$@%$H%$P%$X%$`P%$h`%$ph%$x%$%$%$%$0%$P%$`%$%%$%%$%%$%%$C%$%}X%$%$ b%$%$8%%C8%%x%%CYt%% %% %%( X%%0%%%8Ch%%@C`%%H%%%P%%%X %%` %%h t%%p n%%x %%% %% l%%0%%%h%% 9P%% O%% Mt%% %%%%% %%C%% C%% %% ?H%%X%%%0%&%0%& 4%&%& `%&  i%&( x%&0%&8 n%&@<%&H l%&P\%&X G$%&`D%&h d%&p%%&x(%& %& %&%& %&L%& O%& %& ,%&r(%&0%&%%& <%& %&%& L%&%P%'%%' 4%'%' I%' %z%'( %'0 0%'8 T%'@ 84%'H b$%'P%`%'X%`%'` \%'h %'p%Ͱ%'x %'D\p%' l%'%@%'%%'%%'%%'t%'%0%'%'%c%' >%'%x%'%%' p%'%P%' %( %(X%(%%( 8%(  %(( 7 %(0%p%(8 %(@ %(HX%(P%%(X %(`%@%(h H%(p %(x N%(T%(%( "%(%%(%%( %( P%(%%( %( ep%(%X%(.%( `%(%( %(l%)$%)%z %)Cp%) @%) 4(%)(%X%)0%yL%)8 |%)@CX%)H e%)P %)X !%)`%)h%%)p%)x t%) h%) (%)%ʐ%)%%)%@%) %)%%) %)%%)1p%)%) %) %) H%)%z@%) %* %*C%*%̐%* %*  %*( j%*0 i%*8D\t%*@%} %*H%ʘ%*PC´%*X %*`%*h%*p%(%*x%h%*%* %*%%* M%* K`%*C%* %* %* :%*%* 4%* E%*%* %*%%*%+ %+ e%+%+ W%+  N`%+( H%+0%}%+8%X%+@%+H \%+P %+X%%+`%%+hH%+p %+x 7%+%h%+%̈%+ %+ J%+ qL%+ %+ d%+CY|%+%%+%˘%+ "%+El%+ %+%+%%+ ;%,%%,%,%b%,%, C¸%,(%%,0X%,8%%,@%,H%H%,P 8%,X %,`n%,h X%,p d%,x %, %, |%,%%, %,%ͨ%,%,p%,%(%,%, %,%%, OL%, `%,@%, K%,%c%-D\%-%{%-%-%b%-  hp%-( g%-0%H%-8 1%-@%-H%{%-PC¨%-X%%-`C°%-h%-p %-x%- %-`%-%z%- p%- $%- %-%%-%-%h%-%˨%- nL%-%-%p%-%-%z%-%.%{%.%8%.%%. 8h%. %z%.( %.0 p%.8%.@ %.H %.P%%.X %.` %.h P%.p%%.x%z%.%.%%. A%.%0%.t%.%͸%.%h%. T%.%%.%%.%%.%. %.%z%.Cp%.  %/Cp%/%ˠ%/%%/ %/ %/( %/0%/8%%/@ %/H%ʰ%/P %/X K(%/`%͐%/h%%/pL%/xoX%/%%/%%/%/ %/ 6p%/ oP%/l%/%%/ m%/%h%/C%/%%/%z%/ %/% %/ d%0 9%0 %0%%0%̠%0  :%0( d%00 @%08 %0@%%0H%z%0P CX%0X%c%0`=|%0h%0p  %0x%x%0 %0 @%0 %0%0%X%0%0%0%%0(%0 %0%̀%0 %0%0%H%0  %0 O\%1%1 N%1 %1%%1 %1(@%10 %18L%1@ %1HC@%1P%0%1X%`%1`%1h%1p%<%1x %1 fx%1 j%1 C %1 mH%1 r(%1 %1 GX%1%H%1 Bh%1 h%1 E|%1 # %1 %1%xx%1%̰%1`%2%x%2 q|%2%2%%2  h%2( %20%w%28%2@%2H H%2P m%2X d%2`X%2h%8%2p %2x%z%2 4%2E%2%2$%2 d%2 7%2 N%2%{p%2 %2%2 H%2%͈%2 %2%%2 %2 %3%%3%3%%3%ʨ%3 %3(%%30%z0%38CP%3@%p%3H%%3P d%3X %3` G%3h%X%3p%{t%3x %3 %3CX%3 %3 %3 h%3%%3 "%3%%3 7L%3 q%3 %3 $%3Ch%3%%3 %3D\%4 D%4 N%4 %4%%4  ,%4(%%40 %48 %4@ kl%4H%zH%4P %4X%%4` #d%4h%%4p%y%4x o%4 %4!%4%%4%̸%4%̨%4l%48%4 q%4%(%4%%4CY%4 %4D\x%4%%4%5 %5 $%5 h0%5%˸%5 %%5( H<%50 %58 %5@ 58%5H%b%5PX%5X d%5`%%5h %5p <%5x K%5l%5 %5 A\%5%H%5 %5%5 %5%z8%5 8%5h%5x%5 (%5 %(%5 d%5\%5 j%6%P%6%(%6%6 %6  k%6(%{`%60%ˀ%68 5(%6@ ?%6H %6P%P%6X %6`%%6h%0%6pD\l%6x n%6T%6%x%6 o%6%%6%%6 f%6%%6CYx%6% %6%6 h%6%`%6%6D\%6%%6%7 %7 5%7$%7 9%7 %%7(%70 %78 %7@ 7%7H%7P qD%7X %7`%ʠ%7p%7x !P%7%%7 %7 !%7 I%7 %7 D%7%%7<%7 !(%7 j`%7 %7%%7݈%7%7 %7%%8 T%8%8%x%8 p%8(Ch%80 |%88 (%8@% %8H il%8PC`%8X%8` d%8h%̘%8p %8xT%8 "(%8 %8 D%8%%8 r%8 %8 6%8%8C׀%8%8%p%8%8%8 H%8 %8 %9 %9%ʈ%9%9,%9  %9(C%90C`%98%9@n%9H%9P L%9X P%9` p%9h%9p #%9x%%9 <%9 0%9% %9%%9%9 %9%9 6%9 %9%9 %9 M%9%%9D\%9 K%9%: M%: %:%%: 4%:  (%:(%%:0 %:8%{%:@%ˈ%:H%%:P h%:X 5d%:` ~%:h%z%:p%:x @%:%p%:%8%:(%:%%:CH%:%: %:%%:Z%:%:%:%H%: 4%: %: p%: %; %; g,%; %; n%;  lP%;( (%;0%@%;8%x%;@%%;H%`%;P%%;X %;`%jx%;h%z%;p %;x %; p%;%˰%; e%; T%;D\h%; l%; 8%;%%;%z%;CP%;%@%; 8%; A%; %;%%;%%< %< c%<%{x%< %͘%<(%%<0%<8%{|%<@ %%z%>%%>P%> %>  %>(%%>0%>8 P%>@ p%>H%8%>P%|%>XCP%>`r@%>h $x%>p%%>x%z%>%%>%yH%> q%>|%>CYp%>%8%>t%> %>%x%> %>D%> %> %>@%> T%>%%?CD%? %? p%?4x%?  %?(%%?0%?8%%?@%̀%?H@%?P %?X EP%?`%d%?h%%?pCH%?x W%? %?\%?%?%?  %?%{X%? C%? %?%? Cl%? o%? %?%?$d%?C%@<@%@ %@%@ %@ %%@(%{%@0 b%@8d%@@ %< %8%? %7h%= %4%bx%b$%bh%bk(%bkX%b%%b%%bu%b%%b%%b%X%c%X%c%%c%%c%c(%c8%cH(%cX0%ch8%cxH%cP%cX%c`%cp%cx%cˀ%cˈ%cː%dˠ%d˰%d(˸%d8%dP L%dX p%d` x%dh %dp %dx %d %d %d L%d %d %d %d %d %d(%d0%dP%dX%e`%eh%ep%ex%e %e(%e0%e8%e@%eH%eP`%eXp%e`%ehX%ep $%ex %e %e $%e |%e %e %e t%e հ%e ,%e %e %e P%e P%e X%e h%e h%e 0%f %f ۨ%f 8%f %f  ڔ%f( %f0%f8 T%f@ %fH$%fP4%fX%f`L%fh %fpd%fx|%f%f%feP%fe\%f_x%fah%fe%ff,%ff%fg%fg%fh$%fh,%fh4%fg%fh<%gn%gn(%gj%gk%g nX%g(n`%g0n%g8~%g@%gH%gP%gX4%g`%gh%gp%gx%g%g%g%g4%gL%g%g(%g %g!(%g!D%g"%g%h%h%%h)0%h)8%h )T%h(*$%h0&%h8'p%h@6%hH6%hP6%hX6%h`6%hh7%hp7 %hx7%h7 %h70%h78%h7P%h7X%h7p%hO$%hO%hF%hG%hPD%hP%hH%hQl%hR(%hR%iS %iEt%iF%iS%i T%i(T%i0T%i8U@%i@U%iHU%iPU%iXV$%i`V0%ihV@%ipV|%ixV%iV%iW@%iw%ixL%i[`%i\%ix%i]L%i^P%i_\%iq%iy%iz%iZ@%iZ%iz%j%jP%j%j%j %j(%j08%j8@%j@T%jH\%jP%jX%j` %jhD%jp%}%jx%j%jD%j%j%jp%j%jP%j$%j%j%j%j%jD%jd%j|%j%k%k%k%k%k %k(а%k0H%k8%k@՘%kHH%kP%kX%k`(%kh%kp8%kx%k %kx%kL%kK%kN%kV%kV%kV%kW%kW%kW %kW0%kW@%kWP%kW`%lXx%lX%lX%lX%l X%l(X%l0X%l8X%l@X%lHX%lPX%lXX%l`X%lhX%lpX%lxY%lY%lY%lY%lY %lY(%lY0%lY8%lY@%lYH%lYP%lX%lYX%lY%lX%lY`%mYh%mY`%m`(%m(`0%m8`@%mH`H%mX`P%mh`X%mx``%m`h%m`p%m`%m`%m`%m`%m`%m`%n`%n`%n(`%n8`%nH`%nX`%nha%nxa%na%na %na(%na0%na8%na@%naH%oaP%oaX%o(a`%o8ah%oHap%oXax%oha%oxa%oa%oa%oa%oa%oa%oa%oa%oa%pa%pa%p(a%p8a%pHa%pXa%phb%pxb%pb%pb%pb %pb(%pb0%pb8%pb@%pbH%qbP%qbX%q(b`%q8bh%qHbp%qXbx%qhb%qxb%qb%qb%qb%qb%qb%qb%qb%qb%rb%rb%r(b%r8b%rHb%rXc%rhc%rxc%rc %rc(%rc0%rc8%rcH%rcP%rcX%sc`%sch%s(cp%s8cx%sXc%shc%sxc%sc%sc%sc%sc%sc%sc%sc%sc%tc%tc%t(d%t8d%tHd%tXd%thd %txd(%td8%td@%tdH%tdP%tdX%td`%tdh%tdp%udx%ud%u(d%u8d%uHd%uXd%uhd%ud%ud%ud%ud%ud%ud%ud%ud%vd%vd%v(e%v8e%vHe%vXe%vhe %vxe(%ve0%ve8%ve@%veH%veP%veX%ve`%veh%wep%w(j%w0k%w8{@%w@{X%wH{`%wP{h%wX{x%wh|%wp}%wx}(%w}@%w}p%w}%w~%wH%wH%w%wP%wP%w\%w%w%wP%wP%w%x%x%xP%xP%x %x(%x0%x8%x@%xH%xP%xX%x`%xh%xx%x%x%x%x%x%x%x %x(%x0%x8%x@%xP%xX%x`%xx%x%y%y%y%y %%yp% %0%y`%P)%X%%`%y`%)%%0%%yP%X%%`%%yP%%%%w0%%w% %(%%8%@%H%%X%`%h%0%x%%%P%od%%%p%*%%%%*%%%%*0%%%%+% %(%%8%@%H%%X%`%h%0%x%%%P%%%%p%x%%%%%%%%<%%%%ˬ% %(%%8%@%H%%XČ%`%h%0%x <% %%P% 0% 0%%p%%%%%%%%%%%%%(% %(%%0%8%y%H%y%`%y%h\%p%X%x%y% %%p%%y%%%z%h%%%%y%9%%%%zx%%%% %y%(9%@%%H%y%P9%h%@%p%z@%x%%h%%z %%%%%z%%%%%z%D%%%%yP%%(<%0%%8%yp%@%Ph%X%0%`%{h%h9%p:`%%yP%l%%y`%(%%yp% %%y%(|%0t%%%%z%%T%%%%y% %x%%%zx%\%%%%x%%y%h%%p%z@%x%%%%h%%y%X%%`%y%%X%%z%H%%P%z %h%%H%%z%8%%@%yP%h<%%%%8%%yp%h%%%(%%0%y`%p%%%(%%y%%% %y%%%%y%%%%{h%(% |%(t%%{h%%%l%"<%"%"%"%\%%%C%C€%A%Az%A%AF%B%B %B@%B` v%B%B+%B %B %Cc%C %C@-%C` %C %Cy%C %C G%Df%D %D@$%D` %D %D %DR%D%E %E _%E@ %E`%E}%E %E%E %F e%F %F@%F`R%F%F %Fj%F %G?%G %G@7%G` %G %G%G%G%H6%H t%H@%H`?%HQ%H %H%H%I%I %I@ %I` %I %I%I%I%J %J %J@ !%J`%J5%JX%JZ%JA%K %K %K@%K`%K%%K %K %KM%L%L %L@!%L`%L%L %LL%L_%MP%M  %M@%M`%M%M %M M%MH%N %N  %N@ +%N`=%N%N %N%N {%O%O %O@%O` C%Oc%O%O%O%P%P %P@ $%P`%P =%P%PU%PT%Q"%Q %Q@%Q` %Q%QK%Q%%Qj%R%R %R@%R`%Ru%R%R %R%S |%S %S@2%S` %S %S %S%S%T%T *%T@%T`%T %T%T %T%U%U %U@%U`%U %UR%U%U%V%V %V@ %V`%V %V%V%V%W%W %W@ %W`%%Wp%W {%W ]%W %X%X `%X@%X` %X %XJ%X u%XP%YL%Y %Y@y%Y`x%Ys%Y%Y %Y%Z%Z q%Z@p%Z` %Z %Z2%Z %Zd%[ %[ %[@r%[`%[ %[%[u%[ %\ %\ Y%\@ %\`%\j%\w%\ %\%]%] ^%]@%]` %]%] >%]n%]<%^ %^ %^@D%^`%^ l%^%^%^ c%_%_ %_@%_` %_%_%_p%_%`%` Z%`@%`` %`r *  #w؈ww/q^ߒ ww@ߒ @ߦ @@ @ys@v@?`3@Z@ `(@I]@!@&>` @]@5/޲@H] @t^ 0@W/^ H@Wh  08] ]@qo ؐ/X q@=ߒ @7ߢߒ @2 @.w@ w^`0@H@ @  P @.] M2 hkv @x@v&ߚ@~@?`V@Y! (]@Iq@ @&n^` @ `] `X] @!  hF` ] F`F` s^`0@3`H],#@/@@v ^ 0]@Vޒ^ H@V'@V#^ 0@v^ @s^ H@bh 0`8]]@Ӑo@/ ] @@`] ] /@F 8 @U d +t`H@U\`H@WM1 t`H@ H ] ] @D`8 @Um d t`H@U @uh t`@@W-\`Hht`H@A@  @VL@z PhGN @7 )`9 ` @`@)` $ `O@ L` @`2O )`:   c8` @Y@ L` "@,`,@`,` L` @ )` @ dOВ.@Gh o @/P ]^ @V/^ h '10 @\` \  ? @,o\@(^ hhv h^ `@U?] ^ @VG 0 /Ю⤈`]ww߰    \@U@ ^@@H+'`] ]  I @|\ ?@6 @P krr r @u$\dt`t@_@H#wwߔ\@ :_@\ 3@_ -@U_ )"Āu _ߠ w\ Ϣ Ā \  ?``< )p@P`/th@n Ā \h\q@\ q`\  ?`'q`2p q@w@ \`\ t@tt t @t Ā>\tt @t\ t @t h1 d@@ o @@ d@@Ŕ _@?@Ւ 6 @@owߐ@@u d] @@'# v] 6@Ҿ[@@ΐow@G_w\@Ux@ /h`^ ]@U4 @ dN@ H@@C`]@@'c?] 6@Ҍ[@@h)\ƀ  v^ X@A>?Z  h`Z 0]@T.\@@@ ^ t^hs@@ô\@U#@ /`]  \ @Tݒƀ&@n\ @n\ X @Ԓ ^@O  v !\@#b `  r hv d@?є @qL\ @T@ /p$`p^ ]@T @0@ + @OQ^ @ t^` Z0q@@t  @O@^ d  t^`[`@@sj`\ r@h t@?ho d\ @T@ /,`x]  ] @T]"@[] ^` @%^@" `] \ @b` d`@O F^@s\ 5t`@4\  ?h\`) ?@t@^@ ?@9 0^@N t`H  r t@@( ^@N֐ t`@NҐ  t`H  r ht@ d@?$ h d@? o] @T5@ /\`^ ]@S  @- d ^@@N  d  qq q ^@s`h!v@@>h@>`]@?)' 6]?@6[@?Fh \@> o \@S@ /4b ] @r H d@> d(] @>'c?] 6@[@?h} $@S@'@H0@u] 2H\`O @b\`@Ss@ \`0t`@ \`@ShW\`"8@ ]"$`8J`@'$`8!) P@r]t`(J 2@D`8m ??$`x$`d@^$``t` o$@ d@>V oҰ@Q ?t`0o@* @$`P]@ \`" J`@  @%b\`"?$`8 o!@6 do: @r\@Yt`ot`@ /V⠈bH^ ]@S^ X t\`bP@ ]e\`"`@ ] G\`@>Җ ;t`X``?@*`d@ :D``@>\`X"V\`@D\`XhQt`X\``@ x] 1@ @$`d* !@* $`d$`do \`!@Q]o$`d\``@ _] @o$``o$`` d@=ǔ oа k@= dbh]@= 'c `][@  6@>o k@= doX@Dov X\`@R@/̮x@ު @a&@] @QF] @Q  !  ]@Q@^ ( ] @Qܔ^   %8] a0]@Q9!@ ^ ]@Q)!HF ]@QÒ ^ ( a8] P@Q] X ] @Q^ 0F 8` ]@Q^ @ %8] h9]!@Q)!^ Hap]@Q @C^ X@Q F `ax]@Q F d] @Q @Q}]^ h>#'ᐹ4p a8ᘺ!=`)0 \@`D`@Qe]\    z$zd@H- `* `!` =`^ h"@'- @QI]^ p@/9! @Q@]h&@'ᨒ @Q8]o-\`][@Q1`o\`"]o]a @Q$]o9@@F^ @p^ (@R*^ 0@p^ @@R&^ H@C^ XW@^ p P H@)@]^ @p^ @R^  @H$@ /®Pa ] d H% l@<!!Т]@<'c 6] ?@Y@<ِh@Őwwwwww@OP\` )\`"\ 0@K]@8H@Hp\`t`@P\`?t`$``\`@Lǔh@< \`] @K\`\`P\`X@8e x\` ? @8 ?ð_[ [ Y`]`x&"`v\`\` ] @K\`H@]J@\ \`\`P\`X@M Ot` \`#Ȕ] @Kx\`P\`@N ?@A\`>t`"]`xM @]`x\`s \`P]`0\`X@BH ?@' ?{  $@ov$``c@Z] 2O]`x#\`]@KF1#]@\`H`'`'\`` '`'`@C'o i@7 oNc@3] Oo\`\`c@K]o$`<@ /,c]@E K\ @K "@  ` \ $@L h< @*] @F\ 1\ "\0@J] h\ @Nj \ "^ 0@J]Ā@7`@@7[@m\ oТ \ @D] ?բ\ "\`0@J] o@/@ @c&@] @K F] @K @Np^   ] @J@F^  @JF  ]@J^  #h] ] @J ^ ( h]  `(]@JՐ0 ] @J^ 0 8`8]@Jǒ F <`@ ]@J^ @`H] @J @^ H@J ^ P  h]`P]@J ^ X  ch]`X ]@J! `F `] @J  hh ]@J^  p @J]  x @J] h &@` @Jy]o @/8H @1@N^ @F^ ^ &^ ( ^ @ ^ P ^ X  @ @ېh)@o@o^ X@ov @@o^ @@o^ (ɐ?Ϡ^ `@I] ^ b\ 0@I]@6So@ /` P] ``8H^ P@B ^ P@9 ^ X0 HE^ @^  ?@5 i] @5Ւ'# 6]?@Y@5h*@5 i]@5'#?]o 6@5u i o`@5o io@5i io @5b i o߂!0 /7x`w]^ @J7 ^  d@@ _\` @At`@h@5=] @5y'c?] 6@dž[@5\`@JE /✈`w]wwwwwwwwwwwww^ @I^ S^ H@]   \`]@I '@] @7`< H \`@H] @c G\`@A A &Y_3 "`!ր` ` 2h5\`@H]h.`< H \`oa\`o!\`o \``@H]  o$`<  d@4] @4'c?] 6@[@5 # @˔]wwwwwwwwwwwwww\`@I /d,a']'wߒ^ @Ib` @a  @V \=Z @ @/ @y߀ @! @ۀ 2HP\  i@4Z a@]@4'?c] 6@Ƣ[@4h7\@4B i o!8 i@49!o!0@42 d]@4n'?]  6@{[@4h\@4 do( d @4oa @I*/0aHw]@ަ  wwwߐ@ wwwwwwwwww/w7w?wGwOwWw_wgwo_ @HȒ w\i $`2H_ ֔w_  AX`0,] @Cp @}  @)@w@w!ww_w'www[` @Ҡ "@/_Z` " @4a`]@G_ /w@C;$ϴ @I$ $@_ _7'h_'h'h'h'h'X` @ _ "@@_7Z @_"@C pv@Jrr hr r r r r (r 0r 8r @r Hr Pr Xr `^@a"_^@s ^@t ^@`w`@w`@g_ '`(!pw` w`P'`Hw`0]_ @GZ_^8@_7^8_"]_ @a^@hXv@ i @377'h]_@3n] 6?@}\@_@3ao_ i @34/aX] w@3Q' 6]?@^[@3mo_ iw @2+'c !P]@34] 6?@C\@3)o__ @G@" \ P \ 0 vv v v v v (v 0v 8v @v Hv Pv Xv `v h@ h @ ov@ o\ 0@ @BT r rr r 0 /ਈ`w]@> #\`@G ]@ v@] @ l@ ] @ b@ ] @ X@! ]@ N@  ]@ D@`]@ :@] @ 0@א`] @ &@͐1!]@ @Ð!!]@ @!]@ @] @@!] @@] @@ a]@@!"]@֐@}b]@̐@s] @@ib] @@_1" ]@@U "(]@@K!"0]@@A8] @@7"@] @@-H] @|@# bP]@r@_@Gt`\`@Fh@jo\`@@^ @X`  @M @:@ /㈈bXu]@F<^ !bP@ j] @\  @ c] 2H 2@N!`H  @ T] @ `@ M] 2H 3bp^ @E:]^ @FB h@ @" "]@E*^ !"]@ / H &b@ &] 2H  &  @ٔo^  @ ] O o˂bxoȂ"h ] @Ŕ^ `@D]  o& @ /5ᐈb]@y _@E\`;aؐ@ ] ;@*"a] "@ @? @fA\` `H@ ] @@  ,"\`  \`@Eh%\`@D]7o@ z] @ \`@f  O`@Ro@ /ɮb] "@  !@  !@ @ v\@E?@ N@ @@0O j] @0'c?] 6@˜[@0\@EWhS@8-] /"\]3@D:-bЬ"@  ?]@e\ O@\@X`*"@A\]@Do"  j@0+'c@ B@07 "]@05] 6?@D\@0So\@ /7ᘈbؐ]@{ ð@D\`;b] -Y] Sb M] @ ] "@|;Ā@?`Lv@"\`@?`v\`@DŔh%\`(]@C?"!#8]@/ؒ' 6#]?@]@/b #] ]`@Zvo\` j@/~ c0] @/'c?]  6@^@@/Րob?]@Cr\` j @/] # ]@/ 'c 6][@?@/c] ] `@v@o\`b@CL]Ā #\`]@CC`]@?1p!v@c]\`@C0+c@]omv@/h\^ ^ \ c@ ^ @C]\\  ?@ /IcH]/ @cPN@`@]\`@Bh! @ #X@K^ @ Đ`#h\`@B]h]\`oo]@/@G @cp&@] @C5 @C] ^ Ā)c @C]\" \#  @B]\ ? \  #]@Bc^  @B] #c @B]h &@cx @B]o#@ @e^ vv v v @ W@ /㌈c  j ]@.T] @.' 6#]?@[@.0 / cw]wߒ@C^ -]   ڢJ H k^ @a @ k^ @B+] @bF@JHN  k j@.+'#]@.Dc]? 6@R\@.b3^ c] @B_ @ @@ېĀ¢w]@U^  w w߬ ^ @M]wߒ @h^  @o @!B _Z X`8@ow)#o]@^ @A] @Ò ]@^ ] @A` ^ ]@A"_@o__?@@J2@^  ^ `] @A@woѠ#o] @aQ O `]@A^ @do j@-k+] @-'#?] 6@Y@@-Đc^ ]od @:J 2@ ^  k j@-Gc] @-'] ? 6@[@-@#oۂc!#o]@a Gߠ o^ @B>@ /q `(]^ @A@?'8]] @A\`J 2@%\`! @] ]@A \` @>   P\`]@@`]@h%\`H@@]h@` &G @ao^ `0@@] @ /4!`X]]K  ` ]@@\ @`h@I@\ `h]@@\ h@I \ xp ?\ @@] @/P@`Њ &]v@ / a]wǦ   \`@AY@\`a ] q+^@)I !X`aGḨ`ah^@? @-k\`XZ  h]\`]\`]^@@@T\`@,Ӑ `^@ h@Z7^@\`X@Z_ǰ ~ _@`&@"`_ _Z @.]\`@@0_\`XZ` ' ' ' ' @1'?аh\^ H@c_hV@_hQ k@+ hK\`a(]@@!!0]|\`" @?  a@\`]^@@?7^@H@@]h)^@!P\`]@?h5\`8@?]oې @+Ò k] @+'#?] 6@ [@,@].@A)\`@@ǔ /!ईapw]^ @@@P^ X  @,@2_\w \`a]@?^ 0hT\`^`  @-  a\`]@?^`'\`X' ''@1' ?ٰ_ ^  @- a\`]@?m_Z \`X'' ''@0'o @+G kx] @+'#?] 6@[@+o\`@@M/⼐w]wwwwwwwwww^ @? ^` `@- a^ ]@? ^ a]s ^ !]U   ]``] ] ] wwwwwwwwג^   x@_ @@_@ΐ_ @`'^ ᐔ]@>\`0hY^ @ow k@*ǔ _ a]a]@*' 6]?@ [_ ]@+o k@* d ] @*'# `]  6@\@*o k @*!!] @*Ȓ' 6]  @[@*o^ @?0ww߀ @7  @ H2 @֒ H,`@rh'@ @|瀢 H! _瀠`` h`o&@@l߀ H@^&@ ?20 2 2p @ : &`&`&`&` &`@ X@9̢ tt t t t t (t 0t 8t @t Ht P@^Jt @^Gt t @t 8t P@ /Da ]^ P@>8@x r  @[ &a ]^ @@"^ @8x]J@^ P!@@=]3aHa]]}^ @ h|& b^ @ xo?J "O^ @!!( ]@ؐ O@  O i@) a0] @)'c?] 6@^@@)hG^ P r!@)aF ] @)ْ'?c] 6@\@F @)h.^ P @)!>`!] @) ' 6c?]@[@o @)o r] @)'#?] 6@[@)Ȑ^ P@>v0 /B`aȐw]w@k N\`P@>,` @ r@)>!aD`] @)y'c?] 6@[D`@)h0\`P\`@]  J 2H \`@ a\`@]\`@1 \`P!^ ]@=^ 0@)@ @+   $`$@\`P@>@ /܈a]@  \\`P@=͒!!\`@l]"!J`@2!\`@b]J @!\`@] V1J H" \`@b]@\`P@=Քh) $@o$`@] ?ޘ o$`H"@] "?ΰ! k r@(!"]@(ޒ'?] 6@[@@(o\`P@ /x8b(]@ \`P@=d@m `2@T r`@@@5\` € \ @^` @ r\ *?\ \` "@ t`(\`(r`t`(\`P@=yhbt`(ot` !@(T "H^`] @('#?]  6@\^`@(o\`P r@(<!@F`]D@@(v'c?] 6@[@F`D@@(o\`P!@(""8D`]@(] ' 6c?]@j[@oD`@(  r0] @(I'#?] 6@V[@(fo\`P@ /bP]@ J\`P@<ϒƀ/ \` " ^\ @+ "@v\ *?\ ^ r\`P@<h0 @'!5'"`]@( 6]?@[@@(%o\`P@' rX] @''#?] 6@[@(o\`P@ /bh]@ I\P@`3'"p]c@'] 6?[@@'ϐo\P@'` rX] @''#?] 6@[@'o\P@ /60bx]@a G\`P@<"@ N@ 2H\`  @'1 r] @'m@'\`P@? r\`0@ w^@Y`C "` $Y@w ? $`0cؐ] @ \` @`X`@ ^`Ѐ@"`q Y`Ј  v`И"\`P@:9] @V\`Po\`Po^`^`ot` @& r o" /XbȐw]wwww@& ^ \`P@:@ "@\` \ #c  "@\`P@9]\`P@9]^ c@X РY  \` @ @ U\ ??% \`@Y'D@(w]\`P@9Ԕ____wwww\`@D@[`\`@_\`0 @'\`PH@9]\`PcP]@9\`@` @_*@/\`P@E\` o u@%X@%] '##`]  6]?\@@%_ "@\`P@Yv\`P@:h@Ynow%_hr ]@9y\`PTt\`Pp@9n]\`@` \`0 @ !\`P#]@9bo_@EY\`#x]@9V\`P u@%A o]@%|'c 6]?o[@E<\`\`P0] @98!@%# ro#@#8o]\`@b] V \`Pb@9 ]@@@@4@]  /@ΐ"@,] "] @8\`P "@n]@@Xo\` @!B#]@8\`P  r@$א@B@%] @% 'c]  6?@[o>#] \`P@8ʒ r @$@$ ' 6#?]@\o$@ /c]@ \`P@9{ '#] ] #\`  2]c8 `` `? `?HY`@V`"@U @-` \ *? 2@!€  @ \ ?@h o\` \`P@9whF!@$T r@$_?@ 6@$o\`P@ (O\ Д @$> r\  ʀ]D @$y?_@ 6\ "ʀ]D @$o\`P@O〡 o  `O `@&\ v@o$ \ ov@ /Lc]@( G\`P@8\`    c 2@% $ \ *? @  2O\` \`P#@7] `@\` \`P@8h@\ot`@^\`o\``Oݐ@x Z 0]\ @7\`P@$Xoΰ  o˩d`0/@w @c&@] @8!F#А]@8 F cؒ ]@8^  @8] ^  8]c]@7 ^  !8]  #]@7 ^ @7] ^  @\ ?   ] @7^ (^ 0@C@8В":_@#^ 8 !^ @ ( @7] !^ P 0 @7]w8]@7 h0&@  @7]^ 8Z@] @7 ` ]@7  ( @7] o^ @@iy^ 0o^ 8 @7] o^ 8cȒ @7]o@/`-  @%^  ^  (@\ ? (^ 0c@ E]@V^ @V^ v Pvv v v v v (v 0v 8v @h v H@[o^ @]^ o^ @ /ͮገ`@ a] `@W 8@; r^ @€2 ^ @H@2H^  @"’ r1 `]@"' 6c]?@ [@#h>@ rH@2H8 r@"  `h]@"o@" roق`X@"  PF] @"ϒ '# 6]?@\F@"h@"} roH @"v r o!-/[Ēpwww] @7J^ P@)'x ]`%] ] ^ ] ssssǔ @ #"q!)0 # ߶ת`  ssss] ] @^ @$ @;`k#l (p@$`@ @k@`@@$]@_א 0 OԤ @@)# ]@ؐ_"@&^ P@ې@_h ^ P!`p r]@!%]@"49'#] 6?@B^@"Roڐ@@_oπ 'p@6] @/Ůl  ]^ P@6@1l  `"" ]@5^ P@X HpD ^ P] D@5ǔ`@H@D^ Pؔ@5] ^ @ Z  @Y{ @$ HW: ! ]@5^ P!@! r `]@!͒'?c] 6@[@!h7: ]@5^ P!@!q ro` r!@!h!#' Ȩ]DD@! c] 6?@[@DD@! h : `^ P]@5[o@9^ P@6^@ @U)    @@U_t t t @ /⨈c]@ \\`@5\` #]\`c] @5\`@]Q\`P @! ]@5\`"Ā\`@T\`@6h:@A\`ؤ1\`] @4\` s@ !Ā] \`@!"'# 6]?@/[Ā \`@!<@oo] co]#o] @ /`]@ 8@5\`` s! @)` s@\`@5h%@ \` (]@ ג' 6]?@[@\`@ @Ӑ@!o @ \`o` @/K 0 ] @  H @ ?h@ &\ @5z0 /,laP']@  y\`@5/` @-\` c]D`X\`] @4\`PD`Z\`@\뀢 @#\`  +c] Gap\`] @4뀠`@`@`@ @T\`@50h? @\`PD`[ \`ؖ @YP @`c`; F ]^ @0` @ ̓6`!@*p%\ @  h& ^ c@0]h `@1 "@!  @ sh !@{!F #x]^ @'# 6]?@[F @^ h"H  s@^!F ocp s!@U3F ch]^ @ '# 6] ?@\oF  `@,`@`@`HX `@ o  s@/!F oڂ Go  `2@!& h; @ sF oł `@  @  & h'  s@! F occP^ ] @0 >`+!@ sX] @1'#?] 6@>[@N^ c= ] & & @/c`F ]F ^ @/^ @0 0   /Ԑ#~$~d@ Hd]^ @0^`^`@^`v Ȋ]@OʐU@r @o^`0`@k^ `^ @O{t 0^`0^ sF Z`0F @C^ ^ Ȑ\ 0@Ou*'c 6]?@[@O*@G @D^`(@@^ ^ Ȣ`@OPt(^`0^ sZ(F F @^ ^ Ȑ[ ( @,@OH & & & ^ @0c 0 /c] $@ ^ @0^ PY \`(  c]^ #] @/6F ^ ؔ@Ti  @<^ cД@/(]  @`h!]#^ ]@/߀ 2HL^ @/^  o!@\`(] @6'] ? 6@C[\`(@R".^ @Nߐh*^ @:^ ئ s@۔! ^ c#']@ 6c][@!?^ @.oo] o] @/Ӱ@ /̈aP]] ^ @/@Q  `@7!^ @; vv & @\`@/hY@:v` " "" @N\`@t(@*  t`Pr \`P 7s"?\`"\`@_:o\` r@k o@f sh]@ 'c?] 6@\@o@P so` @H sX] @'#?] 6@[@0 /~ؤap]w @ٔ""@/^ @NNv v v v (@NHv 8^ PZ@NCt8^ p@{ X`v`8v`@@N9v`Hv`P@J^ p_ \`@/h@o\`@] ?a] "@1!!/]@"@!]@ /"@/]@`( @ _t@  w ? o$`@8\` 3`8@]@Mo_  s@'@]9'@#]? 6@^@o_@ soax @ sX] @ɒ'#?] 6@[@#8r H /̖`Hr]  /@`@@  @^ @.?^ @ @9u#H] @\"]`@M>hs@M9ot@Mhu`0]`@8 ?[@7 ?ް<!(@r@@MQZ@q#<`@ ; @@X) @@8@X@   `X]  `]`]@-@G]`!u`p%8@Iv ?I[@r@[@M!]`0@t`Z@MZt 0\@!`(@M\@u`@o%`H r@ߔ o o @غH'`h]] Z@?@# 6@1[@Zos#@[  'X]1o P@Y@@6@ ?`  @\]@78 ?Vo#]`@-㾰 /t`po]  'k@@ ^ @-p ^ P^ Y   @Q˘k @GGk^ p\`X` `3@(\`@Ŕ\P Z ` H]@8"L\@L]hH\J] @ /@0`]@8Ԗ@LDo'^ @,R]Gk@+ "o@8C^ ج s@2!x\] @l'c?] 6@y[\@o\@-4 /^X w@^   @,] ^ p>`Y Y  ^ P !@8`Y @% _T%@hPw_@L -1# ``@7\@8T`H  &@&`&`@L]`( v`( = ] ]s]]`8@ /@Kv`8\ \ @8D] Ja ?Ő@y]/@@84] ?X@\@\o\ ?o_%\@,]@/h ^ ]  @,s ^ `^ ] @+^ P^ XY v `  `v h@R^   @ ]@+^ @.@Kkh+^ @7x^ آ s@g!Ж@`X]^ @ '# 6]?Y@@!@ X@^ oo]o]^ @,^@ /`^ ]@,  `^  `X]]@+8\`\`P@R\`ؔ @d )]@+&\`$@K h!\`@7\`ئ s@!\`] @B'c?] 6@O[\`@]o\`@, 0 /4ᰈa ]'^ @+Œ ^ X@Y '`Xc] ] a! \`^ Y`8]@*֔\` @SH^ ؈ @e 뀣 @.?`@@o\`\`(]8] ; @*^  s@!\`0] G[ 8@ݒ'# 6]?@_\`G]`8@hZ^ \`^ Z`8@*]\@*\`#^ a8@*]^ @R^ P H @6^ ت7^ @]@*|^ "@8^ @Jbh4^ ) Xo] !H& ]^ @*ko@6b^ ت s@Q!\`@X`8@^ 6@?\`@ X`8@]^ @*J]0oo]o]@+L0 /Ⰸb]w  ^ @+? @*\`@+,h@D\`Ot`p@D_ ?@6z\`t@@J-t` t`$`$`@d ?`|@$`x`@` k@53I` "" " " 0\`p`Y@`J !G"`=Y` @bȔ@ ]\`@ @I\`u (@%m t`Pr \`P r"?\`"?\`@Zo\` s@ o@ s]@'?] 6@[@@ o@I^ (u 8^ H@ذoY`@I_ 0u 8_^o\ s@!oۂ" @ s] @'#?] 6@[@ސ@ /B̈bآ]" @# @*E^ b"]t @/\ PX`] `@@ @*a\ h o$ @= s] @y'#?] 6@[@0 /⬈bw]^ @*^   !]\`"] @)"`|`2H\``2@A\`p\` ]\`a@)] \`@P\`P @=  Z\`aȔ@(] "S\`@HhO\`@4\`ئ s@!\`]@ 'c?][@( 6\`@6o@FZ 0 ʀ ] \`a@(]@Lo\`_  G Z @ 2O\`@ʐ 6O\`@Ba]\`@(o\`\`@) ?Ԗ?"@??r@/]8?aЊ?r@@] r@/ @/^ @)_ ^  @ @4@ @Ht0@E\p @H\0@﹒ /"ِ*@H ~ @3ɔ @HHZr@2- ذ@tYer@@H7[@H1 r@H,  @3Z H[@ s@@2 @H [@1 ` "@qY ?@`@E?!?Ԗ?]@ @ $@H1\` 'tJ"H$`@` @ \a]@(\h?ؐ@pX@ zo?ج@H]tJ`@ s@ה hh@x d\@3\ O o$|[@@ O! s @! '#!]] X@ 6@ ?]\ @\Y@X` @\h7 @O  s @'#]] Z@ 6@?X@\Z @o] s @+a]@#'c] 6[@ʔ?@ِ@Gg#@GcYr@G_\@(}@ /.|a^ ] @(9@G^ @ /*b] @v v J@  s@9 "^ @G/h^ b^ ]@'=@\^ ?v J O^ @& "H ^ @~ ^ @ƒ! @c^ @  &@6^ ^ @ O@&^ OΔ  o@@"B@9 '"(#] ] 6?@H\@B@T^  6?@<\@B^ @o@! 6O^   o@!'@B@ # ] ] Z 6@?@B^ @%@Bo^  o@ 'c"] ]X@?@ 6^ @ @^ oe s@ ] @Ғ'# 6]?@[@oL@'@ /Lb0^ ] @'W^ @Ȓ /`@Ò /P^ 0@ / 2@ H `@Fv @F^ h^v @홒 2@o^ 0 o@F ' c"@]]Z@?@ 6^ @^ @sh=^  o @*#'3cb8]][@?@v 6^ @o^  o@ '#o΂8 o @ 'b8]]?X@@T 6X @coX ^ @' @ /ἈbH^ ]@&Ȥ @2  &"P]\ @%\ \ P@M\ ؀ @ $ \ `@%] Ā@Eh\ @1\ bX\ ] @%\ o\ @&ϔ@ /Ĉbh^ ] @& @^ x^ ] @%^ ^ @ &@P x^ @^ @( s^ @ @ ^ @%]hg^  s @|"^ ] @ 'c?] 6@\^ @ӐhN^  @d@셤B^ ] @^ 'c 6]?@[@qB^ @^ h,^ 耢 H ^ b@%N] h"^ ^ ^ ]@%F s @1b^ ]@l '#?][@y 6o^ ^ obp@&4 /P @뻶  ww@보 w׈c`]@Gw HO @*@b)-@*+hcp#x]]]@$,〔@$] @$] c] @$ߘ"@&^@ `  )0`;`^@@``)0^@ o)0"@&L@`@&&  H1ߐ w@;c @Q13%  ]@I`@GZ!(#)#%%]@G.'&))  $#@&]`]a#] $] &] 0#] a)] +&] !]a`]]p]#]`-'](v]9#] v`v`v`v` v`( ) %%#%]v@v`0v`8v`@v`Hv`Pv`Xv``v`hv`p"xv`xc`!p@!]] ] ]]#;v`v`v`]v`v`$cPu@]@F%t_@CH] ] _@] Su-c ] ;"]c  uu]u^  cXr] @$#u u(%X# ]u ]@$;c   u@u0u8#X]@]]uH@$ + (uP\] cX] uX@# u`0upuhuxcX]]]@#uu*1h'A #@#]o&o [ @+Moִ'#8]]@#v @%6? ???? /ଈbw] '̏)?`"^ ]@#? 5` ^ b@#]^  ] @#^ "(] @#']  3 6@_@ k 6"0 8]@_@sssssǘ X`@ ^ p @x .M0p ̵"@ G^ p?='v p@ՐG@;^ X#'v X@p_cP] ]w[ 6 4@ (^ @#9hp ?Ң^ X? @1$Z  oM@^ ^ v p  ?^ p?âoM @ dMo2  d o@H] @/ 6?@?_@@NoO d@7@]@_@?@) 6@9oӐ d@+b8]@_@o 9M0p $ ?@J0/    ' ˠ)'^ ] @"#] 6 ;@\ ˔ \cВ 6]@ <  ˆ@ 8 @b^ p@```2H ^ pZ` "@^ pJ@@H^ pm` >g^ p `?|4@ @v pw@wߤM3 Āoؐ'M4 ˹Ā@ު? ##]]\ 6 =@=` 8^ @"IhM0p oՒ@o^ pM0p ˑ ?@/u┐c] "@ʐ "@Ő c']'zw MƁG@!/'^ ]@" 'c 6]  >@I\  6\] @> h ܚ"ƀ%N @%%^ ]@!'@?@`''!c H]] ZGߒ 6 g@ ʹ^ @!ʔh ^ ]ww@!3`8__ǒ0 w׈` @]ww@躦 "@;@脐@ْ )*O @'cw' wϨ ]@=" @@<``J>@< H@ ,@t@O<`@H] (@謐l" @@W<`L '〤`@H@, pv^  ߀ G〢`2H _^ ]@!W@膒 )  )@肐?l oh7M?6 'ʚo^ d@ +58@ i]%_Ϩ8] ] 6@u\@ Mo3 _/0Y@ _^ @! ]o'N `@< H@ =@@O<`oLo'߬? d p'@ %(]@ 2''] 6 ^@>3M@ Mo6p '߀OT o^  ?] @ '# d p@ 7'`(] @ oւo`o/M0p ! ?@ G@/  P M #10 ]^ @ ' 6] @\ ɑ oc\]@ 6Ʉ Ґh ?@ @/ϮX^ %'] @ ] 6 p@\? a  6cД q]@\ T\`v`!v pw]^@ ]\`^ ʀ 7]\` x @ R]h\``@ K] \h 6] @ r +]]Z@ 6 s@{>  \`@ ,@ /jh`]~ )'^ ] @ #]  t 6@S\  6  u]@H\ Ӕ ƀ dϊ ^@ ]\@^ \ Π \*\}ͧ%5M6 ,@^ X@v X@ N?#aP]]  6 y\@@=` Ȩ^ @h~ ?ڢ^ h'v2 \ ` `!)0% [@ %^ \ ]@ 5'\6 o퀡 ^$!H<]  ^ @>o ^ !@o\\ 5Z@ `]o^ 3\ `[]o^ \ ?X@3! oa   ]o]5^ o\ 'Z`! ]3oڂa\ %[``0 a8]o΂!( ^  @?]o @ )! ]@ f\ v 6@u%M@ oT4 @  d`] @ P\o?M0p n ?@  4h0@ /?ἈaX I] ƀ"'^2 @`ah`"`4^8h`"`-^^@o`<!M 40 +ƀ ?@ Nh;= 5^ x@]h4= ^ !p#] @ah^ @]oo[^ Y@]@oϴ @  d?`] @ Ւ'#?] 6@[@ M0p  @  /Юaw]wwwwwwww/ߐڨ? \+'^ ሒ ] @Ɣc]   6@\ N 6Д ] @\A @@_  6]?@\ 1^ pG @^ ^ p\0\@;Z !Ր `(pM30 Dž@ @@3c]! 6] @d\ @@ ?\ᨒ 6] =  @R ^  @Zh"oӨ  d@ !M a]@ %? 6@5\@ Eo40 M0p ; ?@ a@/ @7 jƸ''^ ] @˒] 6 e@ \ ƫ c\]@ 6 ƞ^`] \@^ \ Ə\*\4'M0p @^ Xv X@ ? !]] 6 f\@̡=  l@i^ Xv X^ @zhA ?٠?٠oMM0p  @ ?0 /Pa]̸ :''>] ]  6 @\ 0  6@\@=^ ^ aД] @6 6] @u\s ^ p G ̷" M1p r@@ ? !] ] 6Z @Q=` ^ @h>^ ͹^ v p Ȕ ?ע^ p?ݢZ . o͔oϒ @Ԓ d%Moŕ4  d@3b@]@ \?@ 6@ 'o%MM0p  ?@ E /̈a] qř''^ ! ] @]   6@\ ŋ@>  6] @\ y^ p0 @1^ ^ p\`0@\` @4@@? "]] 6 ^@=  W^  @h(3M6p ŷo d@H!!]@? 6@\@Mo3p M0p Ś ?@@ /Ⰸ`@]ː? Т%H]^ @%+'P^ ] @^  X@] c] ? 6@W\  6`]?@L\  x @ dˎ ^ @B^ pi]r^ b]W^ ^ ݢ^ Fv ݿ $M2 -@3h@P3cbX]] 6?]@@ = Ī^ @hcR^ ?ܢ^ e^ ^ [Z !o͐oQ^  ?Ţ oȬ   o@Mo2  k@| d ]@\ `@Ȓ 6@ؐo d@h ko`x d@`5h]@  6@\@oQM0p ij ?@ِ /b`w]www___ʥ?' ow$%h^ ] @8bp]@0^ ^ x] @*^ "@$] ^ "]@^ ] @'?]  6@S\  6\] @H?sssssssט ߚ^ ʄ4M0p ?@_w@ ^ X_@+v X@2&_w_ @WG5'c]  6] ?@\@ ñ^ @]h@owג^ ޱ ?ʢ^ Y ?Ţy ?^ X? @Z ` oM@@'~^ w@+P @  b@]_ _@(3Z  ioM@ @n d]@\?@ 6@ʐMo2 _@Q jX`;Z " ^  bؔ @G] @5;^ b] "^ ]@M_ ?Y_^ ^P:\  ?R'_Y@oSv j o@")"]+'@^c]?o] j o@3b]@N'o#@ ooА @ o o"  o@7oⰐ d o@;b_ߢ\  @c ]@! 6 *@1\_ߨ]  @Q`@8ooO! r@'oZ⠒M0p ' ?@M0/w!? \£''^ ] @#]^ @] 6?@\@ Ž 6?@\@ ‚^ M0p @ = ]  ] Z 6?@Ŗ e^ @vh;_ ?^ _ ?ܠ_ owM0p ¹ @?0 /4c(w]ȱ? w2)'^ 0] @F#] ^ @=#] 6?@|\  6?@s\ ^ s M30 r@=`#P]] 6?@S]@ ^ @h25_8D`]\`^ @_਀`"@ doڪ @ޒ oc@@]  6#H?]@)\@7'Mo4 M0p - @T?@/))'M?0p M^ X] @^ `P]@#] 6?@\@  6?@\@ z^ M0p  @<#`] ] 6[?@̖ l^ @}h o͐ @?0 /0ㄈch]Ũ ? ٪ E!-' ^ cp]@X P]^ @R^ bx@L] ^ x] @F] ? 6@\ & 6#?]@z\ sǿ ^ *@D^ `pҚ]^ ғ]r^ ^ ^ bv  &M2 _"@^ X暐@^ X@ ?` v X#]] 6?@9] ٖ^ @hg^ ?ڢ^ ^ 0^ cS] J@%Ŝ ?Ţ^ = B HZ ^ X Z Qaoo2 ^   ? o @޽] oߩd`  o@7M6 o k d@) ]@Β\ `@ޒ 6@o k d@}'oxM0p ސ ?@ /AȈcw]֐? W!#]^ @k%'bp]^ @c ^ bx]@]^ b@W] ^ ] @Q] 6?@\@ 1?c\@]@ 6 ss sȐ)M50 @<#] ] 6?@e^ ^ @h,^   ?ߠ_ ?ڠ_^ ^P^` ?Ӡ_Z#v]^ @ _^ oM0p E @l? /hw?? e)'^ ] @Ւ#ؚ]^ @˖#] 6?@ \@ \@ 6@? s^ "M0p ^ X@ 7<@"v X#]] 6?@] ~^ @h_c[ ] @^ _M3 Ւoզ M0p ΐ ?@ /1㈈cw]wĤ? F)'^  ]@ c^ ] @`^ ]  @#]  6?@\@ (\@`]  6@|?ss  ` C'3`^ ]@z ^ o(M3p o_ @M@#< ] Z] 6?@M ^  @Uh23 Pow_ '&@_o֤ Z`ow^   @:]^ +?Z .o@oM0p & @M?@/"''M?0p Q^  (@] ^ P] @  0]]\ 6@? \ 6@? @|^ Xv Xl^ M0p  @3<`8]][@ 6?@ a^ @rh o @?@ /P`]A@@ /,` ]!@@ /`]!@@  @ tt @t  t @t h@  @ /\` #]@6ƀ4֐Z @S^ @h'vX@"@$qY@  hq @ h @ ] @#'#?] p@0[@@@ /X`]  \ ƀN F@.h!  Z @"Āt@ uHĀF@hB @ om&?Z o@  ]@В' p]?@[@@o@~ o @w] @o @j  oׂ @ /I㔈`А ]8 @>v\ \ ?  vZ @0\ \ @ۘ\ \ ?@ h& @; h @6 ]@r'c?] p@[@h  @  o @^ ^ v vv  ?h@ov @/ 8`  @ rr (r 0r r r r )'  c( x (y$~$b @H]  ] ] &[v ([@چv 0@ڲhv @&v v v *" @wwww @i  ~$~d@H^  `@"^ 0/ @@|hv 0@ڐov 0@wwww @A  ~$~d@H^  `@^ (/ @@Thv (@hov (@/j3 )c(]`"(^  ^ ( ^ 0 vv v v v v (v 0@Fh@Bov 0@>ov (@:ov  "@] v 0vv v v v v (@ @@Ң tt t t t t (t 0@t 8t@ t $ $ $ t 8$ ($ 0@ /Xc8]@ \`8@ >`@\`8] @f >#H ]\`8@^$` $`0\`8@   /ԮἈcP]wwww@U \8@Ŕ H c` fP_'w_ϒwww@Ƣ @M_ Z ` ``_Z (*r^ 0`@B_?Y *Y Y  €DY 6Y  3"  \8h^ 0@] "  @!#+']c`]?][ p@@ݐoȀ`7xo]xo] "\8@_w\8@}hb \8ch^ 0@h]  Q @!#p]'?c] po[ cxo]]@\8ɐ_Y ( e  "H_]`*@X`@ ?z Ov_^ *@X`@ok X] M'#?] p@Z[joU` /`w]wwwwwww@_ ۰\`8@˒ _ @ } 0wr (rr r r r @@_w^ \`8@h@ضov^^^_wwwww5`(#] \`8@ _ }_π`\`8 @ ] _\`@z ;_ @ \`8 ]  @_^r(v"?\`8o @\@a] '?#]  p@\@\@֐o_cxo]xo]  ^ ^K`2H] a_]\@ '# p] ?@\ƀ ^KH] _\@o ] \`8@ o_ϐ & o! X] ]'#?] p@j[zo /4a(w]wwwwwww@o \`8@ےє _ @  0wr (rr r r r @@_w^ \`8@h@ov^^^wwwww_`( #] \`8@( _ @|^5`\`8]@ _\`@ ;_ @ a \`8] @_^s(v"?\`8o @] \@ɒ'?c] p@Y@@\@o_xo]#xo] k ^K`H!]] \@_'c?] p@Y@ƀ ^KH] _\@o`\`80 @] ^g!o~!8\`8] @ op % o  X] \'#?] p@i[yox@ /0a@]@v \`8@\`8aH @]]ƀe ^ @  0Xvr (rr r r r @S\`8@hd \`8aX ]@<^`0`\`@} ?B k#*# +p@ *# f`^ʀJ`H!!]a`]  '?#]  p@Y@^"ʀJH]o\`8  o aP] Ȓ' p]?@[o\`8$/]#H ]!h ]'''''@ժ   ]`8@=#aH]`8 ]@ƀ ^^ ې@]`8@_h^X``@  X`<+0@  O ,0  @ ːt` ^ @Y` ]`8! ] @^[` G#aw<Y -0@ @5\3 aw' !᠔_!awwww Ϩ @ ]`8 ]@Z^\ wϟ=\ +wא `0'߬Z`  @ے@  O 0^[` *O<"?]`8@Ðo]`8Bn#Z ,&,0 -& @ f`J @+ \`ʀJ H'_] '] _] Z]?@ p\`ʀ_J`H_]o@k]@ǐ?Ҕ*@b o˔__]]@O\`)@ot`@ "Oo~]`8 n'x]5']? p@]Ȑo]`8 X%op /9Pa ]@ @ а@%] 8  @ !!] @e] @5 H@Ս !!@ը4`@Մ`@ @է<`@= "@: @@|`1 d@@ @ K` @ՖoĀD `@``` '''''ے] @C Ā@ d"] 8@ِ] 8@ho ܔ \`  cx]3'] c] p?@[\` !#x])o  <`@ٰB@BА] '# p]?@Y@@Bo 3a@ԲBɐ@ԭ]BƔ' p] ?@[@ԝBߔo@/X@b @a&@] @ ˖Q^ x]a @ ] ^  x]a] @ ^ ] @   ]@ ^  F b]@   $b] @  F ,  ]@ F 0b(]@  ^ 8b0 @ ]b8 @ |]h &@a @ u]o@5^ .^  '& ^  ^  Z*@X`8Z X` @@vv v v v v (v 0v 8@אhZ`(@o^ @ɒ o^ @o& @o^ @/D;^  2 #^  @(#^ "@^ (X@@ #`  \  ^ ( vv v v v v (@ӛh@ӗov (@Q]@ӑ\o  @R] @ӊ^ o^ `@;]o^ @ /s8"@ ]  .^^  ,v "X]' p] ?@YϐhabP]' p?o]R obH0/38"` ]^ 8@ ( bp bh^  F ]s^^ @ ^ 8@ x ]@ ^ 8@h]@ ^ 8^ 8@ 8㾠/h"ww]wowwwwwwwwwwwwww^ 8@  ^ 8b ]^@ ]^ w@ #]@蹐@g_o"@_w@蹐@_oh_w-+b] w]@~)"^ ⠐w] @~@\@?"w@~] "q*p   50  @ s]@^@  @;`k#n (p@@&`@ @k @`2@@o @o"q *ߨbȸo"Ъ?   @= ^ 8]@ ^ssssǒ ]_w5p  @^@ @;`k#k (p@# `@ @k`@`2@@do o)^ 8"ؒ ]@  @_o?^o  D b] ' p]?[@oE#  +;'9bc]e"]]\?o p@woww^ 8@ 2@/T" ] ^ 8@  ^ 8 ] ^@ g^  'bc"q](p]    @F  $^ @ ^ Bjj9`)pk #)0+p`@*#@" @ "@^ @"@5^ 8^ X@*Z 8X`]` h*v \(o^ X@ X`Y` v @ o Y 8Z(@o^   ]?@ po^ 8@ @ /yPb^ 8]@ m  , c`@]\@ \ 8@\ @ϒ  \ 8$ , @ @ /T㼈c^ 8] @ H @< ^)0 Z@\` @D O< @ \8# ] @ h_v A @N@`@7 ] \u' pc] ?@[\h>\8\]#']c] p?[@lo`@2` N@"G\8@P\` Go  #\`] 7'#?] p@D^@\`oÖ\8@ @F@/Ȯጙjc+0#@ )0 *"@ @. Δ ^`J`H ] #0] \@'c?] p@ \^`"J`H] \@h.  ^`K H!!](] \@\`'c?] p@^^`"K`H!]\@\`@ I,0@ ,0 @$t@)pt@@ /㈈aX@5]@> H$ *0@ 3\@`  @%(PH$@$`$`$`@it``8@$a,  ta 8t`$ata$`$.p@ E\@h$o `D`] ['c]  p?@h[D`wo /(ah@]wwwwwwwwww@w ˰` @  @wr`r@r` @_t  _Z q`q@q`w_!__ t__X`rwwww @^? @ _@__ d  @6@_"w6_@a0 +  '_`]'?# p]@[_`_%#_ @υ@σ_@h]$-p@ \@ha_`^`@5\   $@o$`  t!%'!]_`]? p@^_`̐@\`@2t`o_X x] 'c?]  p@_@o_ A  _`o!p 8a`D`] s'?c] p@[oD`@ /┈a] @ʐ@ h` @N$,0\@@ @$@N@`H@U  @y5a] /@Ų@] \`@_r $`$,0@\@h6  ܐ@B㈔] ' pc?]@[.oݒ  a`D`] '?c] p@[oD`@ /Dଈc]@ `$*0@\@ ` @B @ @ cD@] ɒ' p]?@Y@D@$)0@\@h6@f\` @ o$`  f!#] 'c?][@ poܒ QD`] '?c]  p@[oD`@ /׮c]@ l` @S @``@ @ @2 \`@ @ &Y^`10@ "`$a,$`@$a, $`$*@*\@hGo$`@   c]A' p]?@N[@^oD@] + ' p#?] @8\D@Go˒ ؐD`] ' p#?]@ [oD` /^c]@ $-*0\ ] @ @  @ \ `e"H #c@]t (쀡 "H% ] r`( 耢"H'] t`(s\\@A! @  '$(p]\ @^ 0hx$ȫ*p] \@Β hn _> D#s] ss\\ 'c p]?@^Dsss\\o  :>D] t' p]?@[Do 3'c #D]Z] p?@i\Dxo  D] D' pc] ?@Q[oD@ /؈c]@Ԣ `$*0@\@ ` @B @ @ ِcD@]  '# p]?@!\D@0$,0@\@h6D`@`0@\` @ o$` ] ' p][@? oܒ D`] ג'?c]  p@[oD`0 /"$`w]w@e $ȃ*0] \@ @ٖ` @ a(`@v @ @ @ @T`#v\a86\aH\a@gw@`_^@v\a@\aH\a0 @@ta@ta0 @taHta8ta@^ o !$#*0]\@ @^ 0hg$(p] \@@ h\ww@[ __ta@taHota8Z `o^ o 5' #D@] C p]?@Q\D@`o ] - '#?] p@:^Jo ! ] D`' p?] @#[oD`@ /a ` ]@ $'*0\@ ] @` @a a( @G @ @ @ @& a,`H@ $#(p] \@ @^ 0hS$ț*]\@ @ hI@Wox5' #D@]] p?[@D@Аoa  ]  '#?] p@^o KD`] ' pc] ?@[oD`@ /Ѯ`(]@ $*0@ \  "@   $ $+0@6\ h `G`O@K ?o @/0@ @`0&@] @dF@] @\ F  H ]@U`P^ ]@N X @H]F `]@A F `h] @: F @ p] @3  x @-] F `]@& F ] @ F  ]@ F! ] @ ` ]@ ^! ] @^!ఒ ] @^!   ]@^! F!(] @ F!, ] @ В ] @^!0ؒ ]@^!8 ` ]@^!@` ^!H@] $*0] ^@’  @]h &@`8 @]o@/$'  @ @ @@^! @ v@$h@ ov!?!$]*^ @0\ 0﯐o^!@ /ha ]  $ g  @ H,aF]:'# p]?@G\FVh] $'#?] p@1[A@  @Ƀ ؈? & & @ & @/b$! ]@ $)0@\@@n\`\))@-9\@@ɔ 0/D଒( @H] $*0@^?`v!F @ s^ @̑ @B^!?@! @@͖ 5v! `@  z!!8] '?]  p@^Ԑh;  c  ] 'c?] p@Y@&!(h!v hv  H!^@!0s]`sF @^ ^!}\@^@F @s`s\@^ ^!$)p@G^0/î⨐a@?$])p'^ @'?v@[R^  @? 뀢@$ aP#('@_\`v@Gh8v   aP]8'c?] p@E[Uh"  5]!'?]  p@.[>h $a( Β oӂH$*@\@/ J @ h* @3! @ : b@C] w7w7@" @<?@ )@ȷ`O)! ] @6@/Ů,@+ )a ] `!`@ς@ /̈b  ] @ v@ hX hT ] 퐒'#?] p@[ /~@  b(ww]ww b@bH]]@t@B\@ €\` €\` €w\` €n\` €e !@s]\`8 €V`0@ϖaЕ:] @ؐ a]@s֔@ @0`4@ϖaЕ:] @Ð a]@s\`( €@gc@s]@XhYϠ!]@ǧ "@s]oaؐ!] ]@s@լ !@s]o`4a@s] o`0!@s] oa@s]o\` @s|] o\`"X@sv]o\`"P@sp] ov\` 씒 b0] '#8] ]Z@?@~ܒ p0ww@ ?@@  _ @ w簆?2O_h_ @G*p @@:_`ow_@/\ (@7 @ "/ ]tt t t @9t bؒ`@ @/] H@ )t a ] t $$ h@ot @)t  ] o @/`@ @ @C \ @b]\ @ h]o\ 㾰/wwwNw@"thF `@8 `@^ @s7]@U^ @y^ @  ?h.o  wg@u@ߐg?`5@_g] @Ғ "^ @3] o֒]@-^ oВ@_"]@#^ o㾰/@pwwRw @HN@C"hF `@8 `@^ @9#]@^ @^ @ ?h.o  wg@@g?`7@_g]@w b^ @] o֒^ @]oВ@"^ @] o@/wwww@h@^ ^ c@ȩ]@^ @_ ?@/®x/ ` H*"@N@ @#] @b`]  H ) !]@@@h"h@] o@/G ` HB"@N@ @#] @ƀ1  H("bp] ^0 ʀ 5]bx]  H ) a] @ @5@śh]@֙ooob@@+ @F \ v@@@"^ ^ v  vv v v v @fh@bov @ /㰈b   ]]] Ꙓ' p#]?@|[궐@ /0b]آ z\`"@\`t` \` s 4 b] p'c]  p?@|}\@ꍐh]?\` "\`@Z U\`@ H@t !!@ŏ\`4@k@& @Ŏ<D\` ?t`   @B3"\`]1 '?c p][@|>\`Mo\`  ސ@Bb\`] '] ? p@|![\`0@W \ h 0 t @ H@N $rr r r r r (r 0r 8@r @N@ HƀN H@pt @mt  ? $ $ $ t (t @@ /`@Y]@ \`@Z@ @ `?"@\`0  f! ] 飒'?]  p@{[\`@ohs  \`8* @ N@ 2H$`  A] }' p#]?@{Y@隐$`@͐ 8t`0s 0ss s s s s (@\`0v@v`v`&` @q*_v`(@ ?°`@7` o$@@\?Bn+",@/p&`@ \`@` d]o   53] 0\  '`Ȕ#]] Z@?@{< p\ Ko\`@@ /Sx`А]@ ]\`@@ @ `?"@\`0  ! ] '?]  p@{ [\`@ɔh7  \`8  "@ N@ H   蛐] ג' p#]?@zY@  @&$`t`8s s@Z\`8v@@pv`@ ?ɰo$@@ /Ј`]@ ;J\`@@`耢 @- @r\`0\`8@t`0@Pt`8   @ $@\`@hhGc ^`] 肒'?c] p@z[^`螐o$@]D`\`@o$@@/A @c(&@] F8 ]{^  H] @ p] ^  !#cH]!#P]d  cX] ] F ` ]VF ch]O cp ^ (H] ^ 0c̀e %x <] ^ 0\@  cH]#] / ^ 0#[ ]' ^ 0㐐]\ c^ 0]\  ^ 0cB ]    ] ^ 0Y (Ā# ]\ c  ]\ ? \  ]%^ 0 \`0] ]^ 8c= c ] ^ 8Y '#H]  ]#c ]^ 8[Āc ]\ 㸖  ]\ ? \  # ]  c]^ @`] &@] h c0 ]o/hwwwww2w @^  @^  @ @^ 0@.^ 8v @vv v v v v (v 0hv 8@o@o^ y  ?߂ Z 0]I^ @po^ @ /Pl` g]^ @ H@`2H^  ƒ (]'#?] p@yYhQ@ H@2H   檒 o`0 @! H ^ 8 € H9^ 06 斒 ! H]Ғ'c p]oє?懒 1o‚ @ 怔  8F ] 滒 '# p]?@x\F אh  h o /ڮ'w@8 ?wwwwwwZ 0??  '  `@`"@^ 8    h`^ @Im z4@ @Ǣ`? @ @_ F ?` sssssssג^  @Kd@G `?|t @ "^ @ @' P ] %;']D\`c]5^? p@xP] \`_"^ @wwwwww@Mh^ @  `P ]3`]\`+''c]o\@ Owwwwww@M\`^ @]@U , 2Oo~^  `O`O9  P ] ]  '# p] ?@wY o@ @ `P ]7 p\`]']po_3 `P ]-x]\`!'#]xox\@f O9wwwwww@M-\`^ @o]^^w ?jo ^ 0\\ \  \ (w ?]@k 0?t o - P ]A+``@aBx@\B]v' p?]@w[@@MBo2 P !]X] ] '#?]or p;`P,]: k#;`i` )0@@!@`@ ?@"q+p(pk! `@*0h  @ *0# @`2H  @^ @l^ (vv v v v v (v 0@͐h@o@^ @l^ vv @h@o@/@ᐐ   ` ]]@|@@"@!?@@ O> @@@"@?@@ O: @/ @&  a]@ H O @A @<N @.)  |4`?@H1ɐސ@Ez! @!] ]  /@< " h o@&o@ /|a] @@N@ @ a] hj @ܐ'`^@ *N@ @ ᨬaa@0 :*`   N@ /@#] /@L@ ON`@ +aȔ]ޖh2)!]@h( @$`]o@r@@@`goΒ@@]o]  @ /wl!a]]@h g`a @@@k(] h] 0 /Öa0ww] @X < !@] @j _@ &_@X`@Z` @`@kF_@Cw@_ "wXO] ho!PD]oZ 0aH] ;o o!8@ /⌈a`@]N@ H ah ]h^ ƀN @op@ݐ(`@ؐ$`ox@  :@2"8 *ĀL@ ?@%]h+ /O@`o@@`@-@@# @"?ܐo-@a] Ȗh@oɤ@@DE@ّ@@D@ӑ㾠 @ꥐO @h @  2H  _<  @2H 㾠 /$Ob8] @- R@8?@&@  HO&@ hJ_<  @ @ h=&@ oV 'cbP]] 6?@t^@Ⱀ℔h# o< 'c"H]]Z?@t 6◐lh  o% ' co"@~! ?H?r?@/TbXr] /@$@ /@ ?` @ @@nv@@|/@I@ /@@Ԑ@A /*@@X)?H\g@uhav@@`X@ ?`< @ (@@ \v@ ?)hMY ?ݰ[@[os@@  o-9'@Ʀ#hBܐ]]\ 6@s?Ҕo@hv@ oᇔ 'c"`] ] Z@?@sҒ 6᷒o0%/ݮ㬊bpr] /@ !/@   @@  @{(` < @ @ 'Y@}@8hxu@”/J J/@@@ /*@ ?bX@ @] O'  @Ȑ@^@ 6O'  o !'@)B@#] ] Z?@sP 6^Z]@1'o o#'!@ B c"h]] 6?@s1]@o  oΐ@B'ox0/2*@ @?@ /` @@,@@~`@{$@<as] @e@@@ /(a ] /@,@ Uƀ=@ov@ K1(#X]\@ @@_\@@ @ :@h6v o Q' c!]] Z@ 6@r?ਔ|h o4 'c!]]?Z 6@rd@@f`?@/l@ﲐ P$r  Hr r r r 0rr (r 8r @r H" ] " " "  " " " 0@/j @@`Hb]@@ /Sᄈb]  o @L@ @@B'] ]X@?@r 6#h@ o/h tߪ!'"c]][@ 6@q?ٔ@ @ rZ q@@@zv0   /" ~$~  o @ ] w@6 @X o+ @<t $ @@t @6 o_@/ N5' "0] ߈] 6?@q\ߦh8h4(] p'c?] 6@q}Y@ߍ@v^@" v\ @d^  "Hvvv@@/H@ 8@ t@t`t`t`t` t`(Ot`0 t@c@e*] t`M c@e"]t`@ߐ*̀t`00 /Ү᠈cw]@ >\ 0@ H@ @ %_w\ 0h)@4 ?@, ?\ (@ @ ˒ ?\@ @ \ (t (_@  (@  ?ڰ\@*@3\ (oҰ@ /pc ]@ D\`0r@) \`(  @\`0h2 \`00] `(@  ?^@ 1 #8\`0x]@\`(o_ g (] ޛ'#?] 6@p[޸o\`0@ /5,c@]@k@G\`0!ƀ; "$ g\`(`1>`"\`0];6`@ \`(\`0=h(o] @ ?o〦 cP]N' 6]?@p[[ko\`0 g o#H@ /܈b]@@I\`0͒@-\`0⠔] \`(  @L "@\`0@ .^@v@\`0h- \`0b]\`( @ ג ?\ ? ?o\`0 ݵ g P] '#?] 6@o[o@ /b]@ J\`0wƀ/ \`(&` 1>`"\`0]6``(@ .\`0h- b\`0]@\`(oo] @א ?o؀^ g H] ݚ'#?] 6@o[ݷo\`00 /4(bȐw]@i  \`0  ~d~@@ @b\`0:] @\`03] ƀ \`0b,]v\`0b%] k'\`0]\`0] @\`0E c]@d1;!c@d+]# ]@d&c(@d ] c0@d] #8]\`0 c@ ]@_ @d_@+w\`0h;5H\`0]*o  gܻ3c]9'#]? 6@o^oo] "o]'o]ot] ܖ g oۂ"@ /{DcP ]@y gƀf ch] @w  @Np #x @m] @Pc @e] @E @]] @:㨔 ] @T! @*#0 ]@M  @ ^*?  j gG5']܂ 6]?@nYܡh9#@@ ]v h2&@%@]vo o#1o#!o#  g`]V' 6?o]  ocX  g o#H0 /cw]w@ \`0ђ #h]@c _@c__@2wwߒ\`0h_@ gX`@ Z`*@Œ g#]'']? 6@n[@o`\`0] "@  oY@9` @B(p@ r< `)0tY@  <  *\`; t *t \`0@B @  g@v@ro z@B۲ƀ ^ ʀ!] #]۪'#?] 6@mY@^ ʀb]o] ے' 6c] ?@m[ۯo @o|c@ /%c]@[ ۼ h  ^ 0 @)^  c @`]^ ^ 0)ۨ^ 0 .<h] ^ 0o^ @-^  &^ ^ ^  ^  @M^ (v (v 0@h@ov @ov @ov@o^@o^ @ /®`  ] g -^ ^  /1' ` ] 6#?]@m Yhڬ  ] 'c?]o 6ڝ `]ْo'0 /T`(w]  \`0i \`0`0]@L\`0Ц  @ @T] _ @\@"\`0@^@v@\`0{h@bUow@j ? \`0`H^] @\`0\`0!#h]@at#p ]@_ ?ɰ@I ?İ \`0`P=]@\`0@b!_ cx`X] ] @aRw# _@] ?@& ?! \`0 `]@\`0]@a_ h#]] @a/w c ]@_ ?@ ?~ \`0p]@\`0:@a_ c]@aw㠒 _@] ?b@ ?] \`0`x]@\`0@a_ c]@`w㰒 _@] ?A@o< ٦ g 8]  '#?] 6@k[o&_ /|H`w]w'      \`0`  \`0]@%_ @ae_w@@@\`(t`(@@M"@\`0@I\`0oh@Aowߐ@В ?ڰ@\`01   @]@ ?ΰ`(@L ?Ȱ 9 ` ww@;  _ϸw`_w'@\`?_Ā @u @  @_@ _ O@`@ 9`@ @Oo`O`#` `? `?HO@H/ Oΐ\`0@ '_גZ Z 0]\`0qo _@_ ?i\`0]\`0@a@ ?]@`_owמ`=@ @ @ @3`O@ =@ @ O@+` @ < _\`0]\`0_]칔o/@@ ` @  @_͔ot_\`0< ] \`0o_o@}o~wߔ ؄ g `8] '] ? 6@j[ݐo_@ /Z`]   \`0D@ @Ɣ h`@- g P7 ]`،-' 6]?@j[@`ب@ @@(@ߐ\`0Lh@\`o9  \`04]@3 ? \@ @^M] `\`0]#\`@z @Y  \`0] @  ?Ű@: 5 `@1 ?\`0]; `\`0@7 ^`\`@p]`?H^`"\` ]@a\`\ ʀ`]@Y\`\`@V]\ ? \`@O] ^@ 5 \`0]і @ܐoH `2O\`o]@ O   gת+'@˰B ؔ] c 6]?@i^@oVב g ] ͒'#?] 6@i[oB@ /ga] "\`0R\` `@  \`@i H``@ g`@# g W h] ד'c?] 6@i[װ@\`0\h@4o\`0@  H\`0] A\`%@! &@5 @:  \`0X] 2 \`a`@] ?t`  g! @6BM@1!@B]I\`' 6]?@iV[@@ Bb\`o g@B+@ B!P]' 'c 6]?@i4[@@BAoҒ g  ]'c?] 6@i[+o\`0@6! `O``! \`0 ]Ŕ \`a8@ި] ?lt`  g֩@ʰB@ B!@] \`ܒ '# 6]?@hY@@B\`oI\`0\`0!(]ꕔ@ޡ\` Oŀ`  g{@Bֳ@ B!0] ֯'c?] 6@hY@@Bɐo\`0Z g o g R oa@ /74ap]m #\ 0 \  ax\ 0 O h ]>\ 0\ ot 0 /⠈a]Hw '\ 0 !] !\ 0| !_ @ \ 0h@Wo\ 0] \ 0_o@ /ܮȈa] \0ǒ\ *  \0\] \@ْ H @1  \0] \\!@E! @@ i@H:  \0b] \\t @\0ȔhR@ 5 o\0  gՠ!'@Bؐ #] ] X@ 6?@g@B\@B\oҀ  g~@Bն@ B⨐]ղ 'c 6]?@g\@B̐o \0al] o\0@ /B`b]x .\ 0 \ b\ 0 Z h ]\ H\ 0\ ot @ (@̠  r r rr r " @ / ∈bТ Z]^ `@H`@?`@  h  6` bXE] ' #"`]]^ 6@gP?_^ hG@y! "P*?^ ]^ & @\v @  v h^ ] ^ @fo^ @ oH ^ b] & v @ov  Ի h ] '#?] 6@g[@^\ $ t \   ?t h @ot @\ot @ /x8bp 1]ƀ(6`@/ @^ ?@hv hn  cP]Ԫ' 6]?@f[ǐh  X h o"x@ />Pb S]ƀ@6`^@ 2@4\\   h83'c "]s 6]?@fYԒh8\@֔ 2@ \\\*\ "H)o۔ ^tvihvot h  bx]A' 6?o]  h o"@ /ٮἈa]@ \ Œ@d \ ] \ @f "\ ] @;^@/@h 2@#\\ tt@\ ֔hW@X 2@\\\*\ot^@t@tv@\*\ ott@v@to\  \ ] t@ov@ Ӎ h b]ɒ 'c?] 6@e\o\  hv ' b]]?X@@e 6ѐӦo\ @  ~$~d@H `@^`@ @/:@ -  @@`h'<`@#`@ Y c0]@Z@Z^`<`@Z`@ @r`o`?Y @k` 2H<`oۢ @ /hb  ]   +-c   #0#(c] @ `H5 \*`?`?@@`Hu h + -  #0c(b8] ]]]#'c] 6?@e#_@0hO@] `HoǸ @] Ho @] O@] "O\ h ҡ!  "0] ''] 6?@d[@h ҈ h (] Ē'#?] 6@d[ @ /a܈b@ |]^ b ㈐]  @] @> x]  @S Hm ^ !`]@I Hc aȔ @A] H[ `X @9] HS  h7' ]s' 6]?@d\ҏh;^ ! @!] O^  `h`@] "O  h ! oׂ! h  a]A' 6] ?@dN[^h   h o"(@   r" \  @\ \ v hv @Yov @ /8aآ L] ?`@/?8H^ ^  ^  @E ѳ h ] '# 6] ?@cY h0ў h1 !]ڒ '#?]o 6 hю  a ] ɒ' 6]?@c[ h  v h oق!@ /\ȈbF`]*^`@! ^` #``" @b]"`]] ^@*^`@ @ r rr r 㾠 /cwg]w_wWwOwwwwwwwowwwwwwwww@¢ W\`AI"? p^2 ^PH ||$@ @ ^@!f@`4 `ݕ4 o @0cg@>#_@> _wY 8@ _g!Gwowwwwwwww`wI `4 !t`cbt@_w*@*X`8"\`\` ! \@G `#3I` ` #t@\`h\`@c]ot`\` @]t`o\@@ot`oo@&O ?ΰ__ `U `G@Ր ?\`c@/  _gaG`%I o_w@._O 2O_w p wЄ!'% #X]]? 6@b^дo_w@_W 2O_w p we3' co 8@t`@  \`@o pP w' c 0]]\?@b 6__Ъ~__o^_w@sW ?X@Ӑ @t`\`@~ow_ p% w' o`(o @/~@ @  w p' co _w[ 8_wowwwwwwwwow p 7  'c]]? 6@bC\! R or]  p' o\ؔ ' coT  pϔ ' coK#@ / c`]@^ /\` p@ w  PG@Nt@t` @] P\`v@\`hϠ' ch]]?X@@a 6Вo\`@ /G,cp]@! /a\` p@ wI X@t@t` @  X\`v@\`䄔hc' ch]]?X@@a 6Ͼϓo\` / 8cxw]wwwwwwww@ۢ q\`@I"@ΐ @t`4 \`@.  \@aG`HI `& p ' #] ]?X@@ab 6\@qE\@_*@X`8\`h4@o\`\`@ 2O_ p x! #'#]]Z@?@a7 6Go_\`@0 2O_ pΔ x' #o8@ /c]@] 3\` \@aG`(I p  ` \`v@\`hΟ! #']#] ?X@@` 6\@\@o\`\`o @/C #^aG``I#` vv v @`]@ ^ ov]@^ ov@ /~㈈c d]!^b   z{4 H  aG`I``8 p!b "`(^ !I  G   zyd HG^  @D p, 1'# #]]Z@?@`w 6·\h.?!I p 1 '#o#  ' c]] [ 6@`V?F eF 9h  p ' coǂ#@ ^!G`$ I`h7^ ^   ^  ^ 0  ^ P* @h&@o@o@o ^ ^   ^   ^ (  h @o@o@o @@B `@`H<^` ^` ^`( v`(h0 @ov`(@~ov`@zov`@:`@;Ґ`@:`@;ː` @<`(@;Đ`0@:`8@:`@@:`H@:ސ @@ `@K`@"`H ^` ^` ^`0 ^`P hz @8ov`P@4ov`0@0ov` @,ov`@:[`@:X`@;`@:j` @;z`(@<<`0@;s`8@:`@@:`H@:`P@;fhC ^ X` @@:/`^ @:+`@;T H0 `@::` @;J H& `(@< `0@;@ H `8@:u`@@:r`H@:o`P@;0 H  ^ Z €"2`v`` o$0 /}<cȤ] "w@rw]w  X\`@R @at`\`@7`\``4    #дجc "@L= ]]_]@e ]\`Ӿ_w? ͘_ _Y` H\ P3@ʺ@4@ oْ ӥ_w\` \`ᅔh@Wot`@?&& @ @?@  @ h  @D 6H @D@D $ $@6`7 6`/|` ]1 @@ /|⼂ @@ϐ ` @  +]h?']?@@ۯ6  @@@  ztz$@     z4zd@?H @6@  ztz$@     z4zd@?H @@@  J H@@@ @@ '<`N "@ 9 @.@`@O<`h<`o.@<`.@@ J @h# @w@ҦL "@LL O h`"@@e@@ҔN "@. o?@Zo@) `@ 8` @9 < @ )``O8`< @/{#@:  ``Ȑ`H ]]c[  ]^ ?/{,`']ww@? @w@ @''ߔ  '_@ļ GӦ@ @GÀ@@>!   _?`w< XG//@# @ 8` ]){G@# @8` ]*Ж_d@Ǔ @@5 @-@__!@>`H__" @4`5 @oGϔ`]ސ@VG@TGhP?]ԖG@ o3 _`Po]@?G@=G H ; @ @?c@+ h+ `H_ ]\ު?h ' _@; ]o\@gow _] ޓ[h ? `ދ]?@ /z3`h] @'8`N@ #@# =@  z$z@ @# `x@] @א @XL@`@R?O`@h?@, @(h `2H ?!  p]B?@/zA ^ >? *p  @` x< +@^ @` @٬ u^ ]`@]^"<^  ?<<>`-p u@ ]@? - @)p@\ <)0\ @@ 0* * @1``0`7* 9 @ ``0H* *  9H * O * /z ` ]  ^  !`"^(*^ n  @ )p#@(p&@)0& i.)p&@.0@.0!n <)0&@(p`&h] h] vo] s`ss]ss^ݘ^ @@d?@WH9 @_ h.@"@ N H @N@ @h @ @0@"J`O@ /y a]X@@  )p\@ J`@  < *\@ ? h@o<  /yG @ @ a 1p@]6Z  Z( \` Y ( @ɒ "@ݒ @  & & 1# @ r]@\`X` @<h@So@Oo@uo< )/yXaЬ]`@ @,ƀ  F ~d{x H   }}4H> ] ] h"ŀY']0[w[w[__@H @ `@= @H   &Ӓ5#@ #]oΤ @ @=`@@ of`\`+p +# *@Q@`g\``@Y@\`@ $\``$\``$@@ O=`oݰ &o̰ @ȐoȰw@;' %4]@U Z  Y (@ ]  ^ ( @@ ?_@o|@ϰ oy  @%] of)/x⬊a']w  @ @~_@ X@ @ P@װ rr r r r r (r 0r 8r @r H@  H_ @ם% rr r r  ww '@נ 4 @]  @@@]  OĀ a@OJ] ))Z !]@ H  ŀ !@] ?ؖ 2p  ]@   @粚 Et \a [ (] ŀ@q p\[(  @e> -p(p%@9,pw瀤@>'ߒߔ@2@ w@ Z "w`] Z  w`v`0v`8;Fa'&@_hVv#@ (]_ @`@@\"ĀE> \Z @h?> @Row@̐o<_)p(p&-p@@8_  #  _瀤! _@O!`owo'@oư1 !oi]@˰ o_@#]oI !@]o  )/w⌈!]@`@W@zFa' "@\ 0hR ^ ^ @Y^A f`\  6\  /\  (\ ( !^*Z \ 0" \ H\ 8@2 @t 0\ H  >?"@$h%<`@Eo >?X` @ov@ot (@Not @ot @ot @4^oâ @] o )/wa]`@ @y#Fa' ~ @ 2Hv "t ^ 0@: >`r rs>\ \ @ \X @N@ v6*% ^@`' @c@^w$ ƀ9# @ |]@]> h?o ^ow@Ko  ' G ; ^(p_ @ " O; oٰ '' ' '  o' o'^@ o@\oh @$] o$t )/vlaР]`@5@qFa' @h0 H- \ 0<`^ss^ ^ @@ &  @3#`@X]h> `@ }\`o@M^o @] o )/vL!]@`@* @*Fa' "@^ 0h$ \ \ @\@  @1# @]h< `@ A\`o@\o@] o )/vn`!]@`@6 @#Fa' ~d @ 2H- ^@"@^ 0h( \ \ @n\ "@ @ \` ^ #`v@]@h< \`@ o^ @\o@K] o )/u'D!]@`@0 @ Fa' ~d @ "@^ 0h% \ \ @Q\ @  @# @]h< `@ ^`o@\o @ ] o )/u@!]@`@0 @g Fa' ~d @ "@^ 0h% \ \ @9\ @  @# @T]h< `@ x^`o@H\o(@] o )/u<a]`Hƀ: !0@] @ @ F@!' ~d@ Hh* ƀ \`0\ \ @\`@  ƀ#@ ]h> @ /^o@\o a@o] a8o]  )/uY a]`@3 @-F!' ~d @ 2H* ƀ!^ 0\ \ @\`@  ƀ # @]h< @^o@\oh H@9] o )/t!]@`@0 @ Fa' ~d @ "@^ 0h% \ \ @\ @  @# @]h< `@^`o@w\oP@] o )/tԮ!]@`@0 @U Fa' ~d @ "@^ 0h% \ \ @\ @  @# @B]h< `@f^`o@6\oX@] o )/t!]@`@0 @ Fa' ~d @ "@^ 0h% \ \ @\ @  @# @]h< `@%^`o@\o`@v] o )/sRa]`@> @8#Fa' ~ @ 2H5 "3 ^ 0@ r r>`\ \ ϖ@\`"@  &ƀ7#@]@3> h^@o@\oh h@'] o0)/sⴈ!]@`@>  #Fa' ~d @ H% h5 ^ 0]J@`H  @@lh'<\`\`@m\@ @  @ِ?3#`@]h< @\ o@W\@op@] o@)/sx!]@`@/  |d~d@ @. \`H ! @  @`t@җ^``t $ @W`t `@^`t^@ t`Hh@J o@  o x@] oЂ @ /stxa])@ /sjP" ^ [   a]]@O@U#4 @@O@c H>  f`> @  /r>㠔!] ]@.@4 #a!@@Y]@D@)/r(Ha ]@`@!@5@7] o  '/rsswwP] ^ Y  @  z$  '$/rswv@v`v`cPsw"@^ ] ] Y  @ # ]@  #%/rwswwvvv`8wwws#^] ] Y Ϛ@ # ]@s  %'/rXwswww w bPwwsw"^] ] Y @ # ]@h  $$/rmwswwvvv`wwws!^] ] Y Ϛ@ # ]@ _ /rF wߒ $ ww'w'www@'_$$!ps__`s] ]Y @ # ]@k _ tt t &$/qXswߖ`ww'wwwwwws_!Z ] ] Y @ # ]@  #$/qwswwvvvawwws!^] ] Y Ϛ@ # ]@}  )%/qŮwswwvvvbwwws ^] ] Y Ϛ@ # ]@$  $$/q|wswwww w `(wwwws!^] ] Y @ # ]@,  #$/qtwswwww w a`wwwws!^] ] Y @ # ]@  $$/qK4wswww@w`w`cpwwwwws!_ ] ] Y @ # ]@ٰ  &$/p!wswww@w`w`a(wwwwws!_ ] ] Y @ # ]@  #$/pwswwww w `Pwwwws!^] ] Y @ # ]@  #$/pή@wswwww w bwwwws!^] ] Y @ # ]@]  )$/pwswwww w awwwws!^] ] Y @ # ]@4  %#/p|wswww@w`w`aw'wwws!_ ] ] Y @ # ]@  /pTXwwwߒ $www@7_%'#Ȑs_^s] ]Y ϐ@ # ]@ @,t@@,p@@,l@@@, H`@, @@,Đ?`6 H@-` H @,6 H`@- 0w @>\@ ?`@0 ? @-y6p @&  6p @, @I  H\@\@ ^ {4'Z`P€뀢 @9 뀤 2O\@h3 ^ [H@o h* @ t@% o͠'? _4p  \@-@   4p @뀡 @' wh  @_o@,o@ %/oHb]  @` H@,`H @,` H@, @, @@+@@+@@+@@/oʮ`"@T^ `"@?^ `@@+ H[`@+ HV`@+ HQ` @+ HL`@,O HF?`(@,Ǖ6 H?`0@- H:`86 @, H4$`@ X]@) H+(`H`] @) [0@   &@`@&`&`o&` oY 0@   @"`"`!@` o!`o 0 %w/nZĀ`@7 ^@  @)  ] P@)_ 뀢@<  H^@^@^ |t'[P@ @. 뀡 2O^@h( ^ Z`H@o @v@ oԈ%'` _ P Z]@)+뀡 @' wh @_o@/nh@,%`b`H  ]@ d ( H ]@) @ %/nb5]@ @ #/nڮĴ`(?`]0p @0 @ )/n̮`؂?`]0p @" @*@@@* H  @ H ` H @@@* H `@``H@݁ @@*r H `@``H@Ɂ  ?`0p @+'@@@*V H `@``H@ @+ @@*@@/m\̐@,A H" @`8H m1`"*% Z@`Ah `@*`V`^`@*ݑ`@*f@@) H `@``H@T @ %/m ᄈb5]@ @@)ޒ H `@``H@5 @/m @)ƶ H$```@ X`H@]@' @@) H `@``H@@) <@@ #/m<`(] @'ǐ&`c`H  ]@' X`$ H`]@' @@/l㰒` H@)i(``@`H  ]@'` H@+d @/lu0` H!@)I#`b `H@'R]` (  @H ]@'k X`( $ H ]@'c Ǟ@Þ@@/l@\ ` ( H @]@'I @/l. ` ( H @]@'7 @/l̒(``@`H  ]@'#` H@V @/lh~(`b`H  ]@' ` H@V @/ld ` ( H @]@& @/lخ༒R ` ( H @]@& @/lƮt@ ` ( H @]@&ρ @/l,/` H @(  (` H @]@& @ r r  @  ~$~d@H ^ ( @3hv (@Go@  ~$~d@H ^  @CQhv @C9o@^ ( \ 8 @C)\ @@\ H@@o@o\ 8@ P9 @ʹ4 r rr r r r (r 0r 8r @r H^  r $ ^  t   $ ^ ($$ $ t ( 0^ 8 $ 0t 8@C^ @t @@7^ Ht Hh @ot 8@ot (0/k@ @xt $t cؐ]w@1_@   Z "@ 9 Z Z *Z9 0w@  ^ ̐^*?^ _@@^ ?@ (/khc]@؁@@+ $r r^@ @7 @ ^@ @kh^@"` ^@^@t@v@Րoov@ @  r  r@  "@^ ^ ?@B  zdz$@ @ H Z Z`  zdz$@ @ H @!@: @   ~$~dH "~7@   @^ ?^@~79`@^ @@/j%0@:@ɡF@ F`"@F`]F` @| @p` bH@p] @ܐ^`( ʀ1  X] "P]@d`0 `@bh "p ]"`@W] ^`8 ʀ 1  "Xh] b8]@K"x]@G b@B] @C^`@Z`@@ '/jͮЈc]@ځZZ@Y@/j@o#   @Ib]I@`@h@@&񀢠@b ] o*@ Ob0@ @Qtt w@Δ_Q/iyi   yd~d@Hb Y`^`]   |$~d@HV  @R?`HN \ @b] @@# Z  1# \ @b]@@"@Z  @$h4<  @ "O@@@^`@"?@Z "?@ @۔ "O@@B H: o@@jf @@p^`@"?# Z "?#  @jZ @ho?@/iḦ       yd~d@Hy Y`^`t   |$~d@Hm  @i?`He \ @b] @@4"Z *Q @ HU: ' \ @ ]@@# Z  ) \ @"(]@@"Z  @%h:< @ @@^`@@Z  @H, @O?h'@ o@ @?^`@Z  H Oʰ?h@z o@?^`@"?Z   o~@/hzJ   yd~d@HC Y`^`>   |$~d@H7  @3?`H/ \ (@I.   b0] @- @^`( @I @!  @ @k H: @$@h ;@J  /o@J /o^`(@/h'8J   yd~d@HC Y`^`>   |$~d@H7  @3?`H/ \ 8@H۔   b0] @ڒ @^`8 @H̔ @Δ  @ @ H: @$@h ;@I /o@I /o^`8@   @Rt@lj^  t $ @I t  @^ t^ ?h@= o@^ ^ ^  @ ?h @zo@vo^ @  ^ @ @^*?^  㾠  /g㸒"" ] wg] #  @@%  cc] ]  ]  @@s @<˜g _g["@3' ΀x  @o @ ]_gZ`w_] @>_@^`H2 "H'! H"% c]]_@=@w%__ ' #]] "?@I_]@@(h[_g@<`hU5 `O o݂⨀ @%  c@" "H 7 `O˂ oȂb OĂ! o"]]_@=1 #0_o]cob7 co( @Eo@yِ c ]@o_g1 c#]]\ "@I  @Sϐ @G_g@>@>  /g0b "] w]  @?L&@  b#]] ]    @?;s @; _[@=Z   &@_ @=\ X`  @`@S@_@>V@>T`` @``''ߖ'''גڐ @Ԑ  ˀO0/fƀv %J @ % !h]&@&`&` &` h_&`@#   @ @ @H_瀢 O %_I @DI`/"@ I@%h] &@ &` &` &`  ƀ&`vh4 @]  H.%ohƀw @y v_I Oي`wI` OoI_IG:@ G_ow`wI` OoI/fƀ$#H] @&`&`&` & `&%J`@% ah] &@&`&` &` h&`@  @ @ Hπ O%&@&`&`&` &`_J @eJ/"@, J @%h] @&@`&``&`` &` `ƀ &`@&`&`&` & `&hL @ O%@  HA%oݚhw@N  @ @ @ H @%h] & & & & o ƀ &&&& &_J` O wJ` OoJ wJ OoJ0/eͮ$N @% !h] @&@`&``&`` &` `h.&`@   @ @ @H_瀢 O%_I @IO%@: O%@@  H %oѰ `wI OoIZn"@ Y@"`J`lY`*Y@h `` rf@Z@0@ /e``H-? ##]\@ @2 @30\@@ ?`!%/!]\ @@3 \@ ?`a4^)v] @`@L7 !' %!# ]]cЕ? \ @@2? \@?` ^@'v O? h@n`O ]  @F\@c@B^` @\ @ `@ Hf hd& Ha h_&@(o@w ؒ@] o!' '# #c]]  @Fg_@1@B^` @* @ `@ H4 h2& H/ h-&@(o' c#] ] Z@ @F@ @ @B^` @ @ @ H  h & H h&@(}o0@ /d(w``?`@w -&]@@c@2 #'9 )@bc# @]d\ @? @2A? \@?@" @ @  ; <NO@   @O; ^: $@v`Oڀ@@s&o&&o&@ O`]]Z @EŔ @@FB^` @_``"@  @ o&o& O o&7'5 ]]\ @E ^` @i<`@:^` )!]@`4@^O-&_`O{ ox&4@v @ #ؓ4`] @o "x@/cv∀ @r` @ ' ##]]   @Eb_@ @*  `"@ Hs hq& Hn o@@4` #2 #]_ @@1_@ ?`v)!] `HO@u ] @̓@D^`   "@ O) o& O o)'; c`]] [ @E @^`  "@`H" h &`H h&' ]]Z@ @D @^`   "@`H h& O @/c8 @_` @ ' ##]]   @D_@ @  `"@ H` h^& H[ o@H`'; c`]] [ @D @w^`  "@`HA h?&`H< h:&2  '@^` @68` "@ )!] H(@u ] @$ O) o&' ]]Z@ @Dt @=^`   "@`H h& O @/bb8@@V`@3#'# c])@∬c@ @]d\@ @< @0< \@@ @H $$@6@ \ 9`N`@`@O9`\:  &@t`Oڀ@@$o$@ O`]  @D_@@ߨ@B@ؐ$O$ o$' ]]Z@ @C @Ē $ H$ $@/bh@h9^ X@ `H& ] @`8@H 1`  @r @  \ &@!@@ H ?@H @$@h &@ h$`@Do @/a@h &@$`Z @ h (2@h \\ \  tt t t $ $ (@ $"] ``@:@!`_`(  0`H $] @  h`$4@_ HY o od@2@E_` ` `I@ (3 jd `H H5`2   @ ( "@* \ `8"`_` ƀg_`(` \ ? o ( 2 o\\ \  tt t t $ o$ ( h&@ @ o\  "g_`(`o 0[s /a @, ^w'7'3'/\ @X@"^ Z" ^   cH@]`?'/^  X`8@'`]`@N`H`@ `[`( @-%`]@@,'#0H)$  `]A@h"H  P@ ] @ "H w_`H`'']@@`w_'k`  9#\  @'?]@ ';Y@ Z  %(@\@ '?%( )@ !' 'Cww3@ 2@`!$k# wW]\ @@.\@ "@^ ^ __Y`0 Aw'#] \ @@.\@_W_Wh'C!'#]\ @@\@_ HCdd`'CAR7 |d`?@`` ?!@ @?+@``O7 |t^@  @v(  chcp-   ! x) X`ww#ww!и#ww^  P`@`]`@`H O@wG_G _O )a] `@@_' "``6@OC)a]@ @_ %@ _GwO_O'3#@  %`H#$@] @] H_O_G`@$40 ''s^ !Z@,0  H  &_O!#?s_O_G?`^^ [8Y @o ?'7C "O3`"HH?`"@D?!)!]@@P '#]@"HF@^ @84p ''s^ !\@(p ̚ 2H' &'s^^ ^@_ 8 ! 2H?!] @  ^ X@] &?H#; @] h"@@q) #x@]oĻ4p o'@q^ c5`@] o ;)a]$@ _^ X@] o&@q_@] o]40 @q_5`] @_GoI]5`@] o.  @ o'3@rA___k@] o _5`] @o _'wOo wG@^ X^``"@  OS` oO&O oK`@_Wo`P Gk_]@`Gf7#]\ @%^@-!k\__@W'7^(oT^ _ ] !@ OK@@qL@qI^ cP5`@Z]o>^ ok_'kk6`#@G/ O"!$hk 8 8 w_ h &k 8w_'k o^o @/^z^ @"##``]\ @@,\^ @@ ``]\ @@,\@^ @w @@` '] `2@H@ *o_*#hJw@? 4`" @ " @ ?# g`%w@5' ?] @`H3*p`-  @ (oh#`!_ &@# @g  ow@__@#$ 8hw@h #`H*hwowoo@ /^c8]^Y@ Y `Y (*?Y  k#@] @`$@\1)  2H N`@H) @; (`@H/0`(@z 2H^  hD&`(v ^"\ @^^^^ (vvvv &&(`vh#@:o^\   ?h a #] ] @\ o$ !]@ 4O o  /]^ #`@]@`@) 8] Z +  `2H! Y (*? + '))'c9 # ]#`@^ c`@ F0s @߀ @q_@?@]$@c @^`8_7Sw-1_@_ "@#) 2O `2OF0&@Fؒ @ @]  HV hT&a]`$G ) #@]o ] Y @? ]_@ `@ϓ1` "@  Ò   o&`4O&o F0@F o#) 4O o_ $GF0@]oF0F0@F O#)h] `OS o^+ @cv oD@ @ 6`3`@?nI@^ Y`8  7 `3`^ (*?  0 H-?6p31p .h%nO@6&6 H& I@O@)0i`di d`@ `@@ `h@ O@6OԞoҶo  /\{@F`0s@l H= ^?H8 `0`@ 1 #8]Y@  Y  `Y (*?Y  "@! :`_ @ H ^2 v` ?e h 8`  v@_v8hv0 v@w0^8^0"^@! *g@6 @W^8h v8\ [  2H^8v8v@h ^0@^@#v8`" @ ! ΀6\ ^Z @@ Z 0Z 8 @h ;`r @r 0r 80   ^ `4 @v@CB? 8`@C?@D &# && 0@/[㴲``@C#< @C!@De ' c` @ m]]@=[4`@l H &0@/[Ү``@B < @B@D; ' c` @ m]]@=z[4`@B H &^/[\'\ ă@M^ Hw #@  8v @v H^ )X@``"@]\ @@)\@_^^ \`[@Z \+(a]s@^ [`*̀[`)a]s`^ [` @)] s`@@@%][@" \\ @ "@/\*?\ \ L @@ww\x @&' H  $P^@  zt@ @  ## bp"wwwJ@ @ `^@  zt@ @ 2OJ@;&`]\@ _# @]@@) _ v H'P]\ @@) \@@3^ H5` H!?@H^ @ h#@7' H] ]  8@<]@@h\@| '-%; b@a`!(?wgwwwowO ] ] w_wWwG!p^ @@/'^@ Hu_O '+ #`P] Z]@'#@] @@ \ #c] \ @@'\@ @''` @_\ @tL` @ L 2O  @tH! (c]\ @@[\@ "H^@,^@@9L$L  @# L 2O #`@]@ H' )M@! ]H @] M`H  @] `8@^]'v h!v Xv `]\ @@'m\@v p$>@U@@@&H!@@?@Uyo%^ `v h@S.&O!o@___ #@O ' 0] \]@: 7@o@}ob]Z@o`L` (]  6]@:^@@QBo@ "OJL`o0#)!  @]]` !]@ o \ #"h]  2]@:Y\x@r^@o c`] ]X@ @: 1 @d'@B^@@] o$@&]\ @@&\@ @R>^@@ _J `@6`."@1J _^@]@  @_^@] @   H  @ o'#b] ^@@Ҷ @Wo* 7' bx] ]@]@:G 3o_^@ G_*@B^@?_J `"O*`.G_J "O*o^@ ' c`]   1]@:%[@@B@o @ow@o@+#`@@@-?]`@ ' #X] ] Z @9#@۬)  ] b@]@^ \ot`H@So\))!]@ @- ' #bP]  Z] #W@9׺@  o'@H@m]o '@^t oe@ @^ @/WMY )aX]\ @@\@@ H#\`8 )%Xa]\ @@\@@ @]\ @@\@ ? @@}`+~!t>~@t/W@I"Or~^@@!p@\ L5# @>] @@H')^ X! J@] `H  `@]^ `L@ H' @]7 3 `b@]@f])a] H9)^ XIH `@]  h@] 9) `]\ @@%e\@ q `]\ @@%Y\@ G)^ `>^ 8 t@>r^ @;p@~cJ@ @ $%Z"o l "@  ho`H  #~[ @`p"@ > @>Wt@^ Z` tt@@'t t ]>o^ ^ H w@~k{ @@ @ H @r^ K %!&"]\K}^ `IH# `@] Y@ @ "@^ ` )X]\ @@\@'S^ h@O @K@ @ `/@  H&c] \ J'@$\\@ H ~S`@ ! Hb^ h#"c] Z '']\ J@$\Z@c][@@^ p H &]\ J@$~\\@@] @`@ !&#] \*I'@$i\~@Z@ 2Hi']\*I#@$W\!>@[@ "H R!(@]@`4@ 5 'i`?`HX!@`\%o]@4@95'!>c `H$@>[@@; `]\ @@$!\@ ^ hOL@@ @;`@ "H ^@ 2H`+&^5 `f`@!@ ''P]\ @@#\@Ā &]\ @@\@ v h- ^)v >W'@k_q`+~o& Zv H5 [@]   ' P] \ @@#\@J '`P]\ @@#\@h -@#ob]\€^ XI H!  @] Y@@ H %@V9>  O @%  8~v @v 8] "\ @@#y\@%#@]\ @@#n\@ !(!x A] \ @10 @#`A\3p @9' ] \ @@#S\@ ;&b]\ @@#G\@" )a]\ @@#;\@ `"@ 59>@@Zv 8Yo+v @@ !>o%@@#o{^ X>O@o B@' ];]^ #\@6~ %@`o%^ `]] Z@ @ @6! )"@! ] ^ X] @Ԙ o!!>@ 9>c@`H% ;~Z "^0] @`H'&]\ G@"\ >[@ H ';~S@`H a^ `J@`@v 'a]\ Gl@"\Z@@]~@r`@8]\ G/@"\>\@ 2H^ h9^ >@[@]@ @!##`]\ @@"y#~\Y@']\ @@"k+~\[@ HZ;!% ]@(hS;%&0]\ @@"S\>\@$2`8J ]L@ @h:;@]@@g+'!?@^ Z@@"`!`P]s]q`]q`]q`] q` ](q`(]0q`0]8q`8]@q`@]Hq`H]Pq`P]Xq`X]`q``]hq`hv `P#`P^ `T`2@ ^;~@@ ^o"!@%)X`_@]@~^ 2O; ? >Z\ %+a ~@]  [s^ot @o&@So%) c ] ]Z @5 C@c )! b@]]!@^ Xo>ooY@~oQZ@>o?\oҊ "`;^ x~w^ `r~t@ ZH@ @'&] \ 9 @! \] @@] @@')##c]\ @@!\@^ `?@s'%^ H@_@Z@ q@ t  8v Hv @t t t @LSv 8  >b>]@M  "H %[D`l@%X@"H!)#~@^ Y@@` ]s@]q`]q`]q`] q` ](q`(]0q`0]8q`8]@q`@]Hq`H]Pq`P]Xq`X]`q``]hq`hv @NZ[`X @9 >@\@_@ @@mX@>^t^r!)#P]\ @@ \@ H55`L`H#[@  ~fz4@@V!@9 >G!@>w@ 8v @v 8v `Y@@SV''_8@`? @]& \ D1@  ">]\@ Hr%%'5 ]  ] F\@@4j'@}2#@B^ X@+~w ~\Yv 8^ bpv @v x@] Zv `@˒ 6H'^?`@`#O@~O"@/@@8oO@#]\ @@ v\@#~R2 @ @ /@^%` f`o"1 -' (]]Y@ @4 6@|ٺ@B@Ґ@}ِ #!'~r@X@v x/9`L>')q@%_@c7 r@~'%t'w@~g%`L@~?!)'$!/r@;_~/~Ș!~t@'Z@7@r;_~7!!>'p@@ Z>'@q@@||;&`"]\@ CN @'&`]Z[@@@ @@|` @O9>gH# c5`~w@\v `v h- ```@!>?@^ H[@@`~[@@*5)>@\%!@]\ @@\@ @) &!]\ @9>Ц\\5)s`L?%`L] `HI#%bx] \ @@S\@^ X H9)9^ >_@ĀY H{!~>@`d!@9>%)@%Y]H^ XI@`H `@] (@] 5H#~#~@ H" 'a8]\ @8' @-5 "\@] H ' #a0]]_ @2Д I@` ;~~Z@!v 8>\v @^\@ o(v x5>Z@YX@`L`o%`L!‘>]@@ o΀ `G`G9)!] 2G@ ^ 8o~oKY@x]`G9%#0]\ @$@;~\\@!# ]\ @>\X@: @Mo &П^ o: ~@oY@_o\@`@av H?`` M~O@@"@R?8oM##]\ @@\@ @ '~9>R o/@ ca ]]  H\@2' @z@B@>Z@z4H)&!] \ @@S\\@`L?%`L > @oso-% p@t] Oo?@J5>@dok!@z O@# ~a@ \]]?@1[@@z@RB@^  f`@o2" !][ ]?@1\@@}o^9)"X]\*AL@\Z@J HJ`.G>?@Y]@ H,"X"X]\ A.@\[@@~7\] \ A@\_@@@  ~@@d@""X] \ A@\\@J`.@"Xo|/`[]%o|@@#~'@\] \ @@\Y@(v #] \ @p@Q\`@^ g# g>G@`HZ^ Xv `"X]\ @S@c\Z@@y"X]\*@B@T\_@@y@v hE`` >^ x@@d#@ p@>@`O]o^9^@ ;>~@@ d"  ~_oI#O  o#o\oZ@!@`>g@o @oY@~%o|@`@]o>@_@$ ;oh#`\`H    @14 [oYuo@ނo]\ @6@\Y@ H@`O"X]\ @#@\[@@ J.O)"X] \ @@\\@ I`O․ooZ@o[o\@oZoYo[o\;~[@@o! "~Д@]oր  @W0!@&~!@]t\@ @@\@Y@@9~t@`L?o%`LoZo' ~o%@@oY@I !5 >p@!@] 6H&)?`@`c O@~O@"@/@@8oO@c] \ @@B\@2 R` @./@)>~@\%v 8_v @[@"xJ^`h 2OF^Y"8C^!)!X]\ @ @^ @\@]@ zo2^@o-'o1 @xؐ`o^ a ]] a`^ `@z^ Xot##!%#@]\ @@\@ (c]\ @@\@ oT@"oK] ~~b]@G O%Z@`lOx@Hg%@'@Z"7^ h 2O^^ @o^ ') # ]]   D_@@/a`^ h$@'  ?]@/U_@#@0; ^ h~&@]@?@w~ Z@xRu `Z] q@ % u @&^`  f`o @>oY@ '`ظ] ] B[@/ @^ X)L ]H; `@]% @@z-]o~o[^ H8@G] O '@]@ 4@ ' ;~oP @ #`]  AZ@] @.!) ! "@]]^ `@z^ Xo oPZ@ #] ]\  <@.)  @]]^ X@y oi"x] \ @u@#~\[@<( @@W@] @ @<'9(#]\@ @0^ p@>\@_@@'`] \ @@}\@%#@]\ @;@\@\@!oΘ>~o[ >@oZ `]]  >[@@.Y# )b@! ] ^ X] !@y} o9(@]@$OKi'# c`]  ] \o{ =>o[@~o-[oY@ ' ] ]  ;@.'\ )! 4 ]  ta@yL^ Xo!&~o[ '`] \ @@\@'$X] \ @Z@K\~\@@g X]\*@E!@:\\@'`]\ @@\@@]@`4@ ' ' c] ]  \@-ϔ?@^ Xoi #] ]Z @-” ?@^G@^D') ]^ X@xao >o[ ~o[@@o_Z@@]\*@!@o\>@oOY>O@B@j 2O1 + ~@o&@o[  ~S@o#]  @7' #`]]  1@-l[@@v6@B`@/@v.`@^ `'&]\ @@K\@ ^9` `>f`o#@^ `o^@v G^ 8'@vO'o@uo^ `"]\@ @ @l\@@^ o@o􀀤 ]>@_@p@@]r]r]r] r ](r(]0r0]8r8]@r@]HrH]PrP]XrX]`r`]hrhv @FZ[@`X`G7 @[@  >\=t@^o)to  "@ @oZ&@^ `o>-@@Dڐc@ @o!)] @`4@ )'' #]!][@ #Y@,> @@{&o2@K] o)'!)!] 4@# '; `x]]-^ #X@, @]$o!`p@-] o'@P5#t o+-@@ )/JⰈ``]\ @@\@?o& "]\ p@ \bp] @'$X] \ @@\@X] \ @@\@@`)"? ' P]\ @@\@> h6#][@@-'']\ @@r\@]\ @@h\@#]\ OѰ? #c]\ @@T\@oİ@M''oբ@ $/Jଈ`X]\ @@<\@2 @^/Jz\\ Ai  H#`@]@ @)`@^\]\ @Z@^ XJ`@- @])  "@] !8a]]@v^ Z8' ))-#! # @ ]`@] @"@@t\ "H\ (`$@\ (@^ XJ @]\a]@v]\ ( ?]`X*ʀ^ h^ h#@#$h39)' H]][  J@+ ^ h`'@@E?^ f`@ #&c ]\ @d`@\@ "H7 ^ 8 h7 @ز 8v 8ov @"p] \ @@y\@/'#] \ @@\@ @$"] \ @@y\@hX7 `T "H ^ ^ \ oo_`-') !P] ]^ #]@+ @ޒ`h:"@#oo'@^ Xom@^ Xo<] `O&`@ $Gi]`X@^ XJ@; `@]#) a  ]  X@!]]@v oR]`X@ ^ Xo@O-t o ~`^/Hb\ G &a ]\ @ @y\@ 2H- (!]\ @@y\@ 2H &@] \ @@y\@ 2H &#] \ @@x\@ H% %] \ @@J\ @ w \`@ww @`H= `?H8 '!0] \ @@,\@&] \*@!'@\!'@"]\ @@\@'#p]\ @@\@ @?@%&]\ @: @xG\@?'h6 @ H\` @ @ @H7'"] \ @@,~\@$ ] \*@!%@\!%@"@]\ @@\@#!(]\ @@)\@ `?@H!)߀ H!\`Y  @B"@ ] @ H6Ô!)!]\ @@\@(`]\*@@J\@% @X@r]? 2H)6 @2H%6 X 2H!6 @P2ot@o!)@? c4 O!) H 1 o!@Mt o /G⬒勔 #^`@ ] Y @ X@ #Z '@C@ #' ' '∺c^ [`0 @ ]\ @G@G\@ @9 ^< v]w#`g^'ے@"Y@ߔۀ @P^@Y @J_ߠ$  Ow_$@ 6o^ ]\@ @@wt\@@ "O^ d2O^ ?@ ' H5#`@]h1&) c!h]]  L@(]@qɪ@B^ X@^ "@  O‧  o& O oڀ ]  K@(]?@^ X o& & ~`  ~d~/F^쀐@@   @q  w wOww@ "@?h"H\` \`  't` ] \ @@\@ "Hy \` @ H*#$cX]\ @@9\@#]\ @@*\@$ ] \ @@*\@#c`]\ @@\@\` P"H @!&!0]\ @@\@@OF\` @@ ? ?23@ \`(2 )p@t`(h 3&a]  x\`(\`t`(`X`"H  j \`(@ot`(o|  ^/F갮4\ r]XI`H ]h!?c` uh) ]h. @f N@"@.@`N@ 2O`.@.`hY 5') !p]]   M@'^@̲ ]h$ ?@p^+ @5! `  M@'^@)]h "@]!@r ]?@'^@]h? @@p5 w@pѐ  wϖ  ] 'w@eh@Kt o0 /E/0"ax] @ H_] @l!@K'J`0"@=J @p4'뀢`@' c@@ ')!]@`@ 2`a@]&] h8# #a]  ] [@'e O@,o'' c!]] Z @'T N@h xO !@q$] o)a] `H & a!]@]@ "/Exa]@ H ]@k!@ a@o] )(Ѐ H a] ]a @#] @@#$/E陮؈``]`H4@ @ h-$@ !] @ok /#`]\ @@/\@ H```` )!]] @ # !@r]h] "@@ &/DY؈`H]\ @@\@@o= @pz1   |$z$@ H@oy @~"@o $h]^ @@^@"@^@o4^`  h@f`@o$3&c]^@ @ @^@ @(a@]^@ @@u^@@#&b]\@ @@i\@@^ @Z"r$]\@ @ @Y^ @\@[v @rh @ov @@^ @/D߮Yƀ@3)aX]_ @@:_@@o0 2H1^ 8#`@]@`@!'@^ @hv #] !] [@&$ @~aX] _ @@_@ ) ! "@]]a@q;o^ 8@; 8)$!Xc] ^@ @@^@@^@n "@*^]_ @@_@^Z !# @] H\ )'! c]  !] !]^@ !@%9 @}"@]@p^?!# @]@!%!] ^ @@^@3&vc]^ @@^@ @)' #] ]^ !@%3)@}aX]^ @@^@ ) ! b@]]a@po!%@/C% $!ch]\ @@p\@]\@ @@e\@@*?\/C<@5^'\ 3w Gaw ] @m˖   &'ː`^h]  ww \ @@s\@w_Ā'$)#a@Ϫ# @wwwww_]\ @@s~\@Ā( )%X?] 303] @@]@@m  ` @`]\ @@\@ ?_AB')_X]\ @'@\@@mo@c@X]\*@@\@!#@mm ] \ @@s*\@ ĀX]\ @@\@@m]@n ٠˪`_2@m2')(!@]\@ @@\@@#&c]\ @@\@_w] H&] \ @@r\@^XH@H `@]@@a @f^F0Y@+ cȀ ] \ @d`@g\ @+&`]\ @@r\@#(c] \ @@r\@ c]\ @@r\@  |`?O__ƀD'#%#]\ @@r\@ (_c(@]\ @@r}\@_&]\ @_@\_@!)!X]\ @@\@@l (!@] \ @@@ϒ\'#@] @H^XH@H  @]@_h%'# a]]Z #^@#۰ @|o_o9#&_ ]![] @#̔!_@| ^`"@ 4O_ o&`O o}_z'&H]\ @@\@   @mk}z$@@i˂ 3`'_@l_@l,_(@]\@ @@\@@&b][€9# ]\ @@q\@&"]Z@#&c] \ @@f\@ ^XKH cȊ . / ,/w]\*@_@O#(\o_@ o#(@F # ]\ @@q\@)&"]o\@@l @{"@lP 9$#h]\ @@%\@o @Gvt ow2 p^/A宮,\ Ă,@,T H\0`t0;%cH]\ @@q_\@ H/& ] \ @@qQ\@ H/ @ 4H&h6 /t^h @ _7[` @ @_7Y @+"@@'wwwwwwwwwwwwww\XI`H+ `@]@ u H\XH@`H  @]@u \`T H4 \]`u 8+$^h`Ȑ% H] u P\ @@p\@ `j (PHU`\`@ "HQ]`]\ @@p\@ `@!## ] \ @@p\@  `?`?@2H)#$F @`u @ &0`] \ @@p\@ "`E0 &Y`H 2p 1_)  $ H1ւ w\ @&\@ d`_7Y`8ŀ @J "@\ 4H&?@@)&"] \ @: @hF\@6 ?h3& 2O 4O o&`H" %a]\ @@p[\@  g0`HcH]\ @@pJ\@ "H  H &#]\ @@p8\@ "H `H !&! ] \ @@p'\@ "H `"H/3# #`]\ @@p\@)'#]\ @@p \@'_7Z @@-  @E_7Y @^h4 @"u 0% (3#`@]  $OE0] 0)\XJ! ] H % @] (#] @lo.0#' cb ] !*[@!r])\Xa M]`!H  @]3 b@]o %'+ b] ]] !)@!U\XH@`H; `@]@zo)$F!И`]u @$O ! "@z] o݊ Eo؂ ]\ @@o\@E `Fou @ ]\ @@ow\@ ?*~PJoH@`2Olu  @] ogu  b]]_ @!!(\XH@`H4`  @] @yŒo)'% #]][ o!'@E=t oӤ6 0w^ \/?p4 Y`8  H> `H&& \XH@ H<` @] 4@!N_@_h'c]^ @@ ^@ 2O\X%] ^ @@ ^@ H "?\X\@do\ (: @/> @# '@0@  #b]]Z@"@  @yJ@jQ @/>@xU@0ˠ: @iu  .z@io  "@i] А`H @h] H,@^@@# v v ^@ h^@@~`"^v^@  h ^  o @hZo @o^ @/>d@Dx '# ]Z@] @ "@xj0i`); a ]"@ ]b]@k9\`\`"\@@8\ ?\@* *o]@ '/>]# ]Z@] @"۠N H "] @x@1) ! ] D \!@k]\ *?D @/=5 ^ @6 )'! ]   ]a#c^ ^ @  z@   xd @  + @Q  I2@O] k@j]@^@ @j] @^` "@j]^`*^ ^ @@1))'! #]# ]! b "!""݀@ @^@]@j@^`@j]^` "݀H ' ] ]\ @h"@j]@c]@ @j!oo  "@W]@@x @i7@@C)*0`/]"(u\Ā\" \ @\@\ @g\  \  @\ @g\  @g\ @g\@g\ ݦu *o]%i@^/ F^ ?^  8^*h 1^*`" A\@ &\` @g\` ? A*0^*Z "*^ *Z @g[`8oX`8@o"@g}ot`@gyot@@guo^*`@gqo^*h@gmo^ @gio^@!E/<̓,0@& @B*?)  n`?R$ H$ h4),),*\,.$.] $X@p]t.t*`" r)p$$/x@@B l@@B X@@B T@@B `@@B \@@B/@@B)@@B)@@B)@@B)@@B)@@B.@@B*\@@B.@@B.@@B @@B@$ $@h#@@B @h$`H@fā@@Bs%@@Bm%@fh L% @ @fJ%~ /G /*%o*%% @ ?@@BJ.@@BD . y@fK@@B<. x@fs@@B4.@@B..؁@@B(.ȁ@@B".Ё@@B p@@B d@@B h@@B *0@@B*8@@A*p@@AZ*pY q@@A" )0@@A Z*`y4@@AZ*` @@ @@@@A&Z*`@&  :&@)p9 @)pv@F\@+@@t?F^@+ps \`*h 9 @fT^@@e^@ov@@@AZ*`\ @f  @:\ *?\  H3 @ r r\` h)t`@e\`^` @ \` "gt`"v`^`t`hv`@e\8g\`` ^`\  ? `H o\`\@e\@ 2O^`@@AXZ*`@ \@@e\`@e\`@e ?t`@/;+@ABZ*`O 7  (c\@eh @edf\L@I@@ @@4 @@?e `? ?`2H ]L@`/@`"@]]@eW\ |@2O\(h]\@eKo ]\@eE]\@eQ  Ho@eZo `oХd`/:Ѯ$@@*0) ww@w`8'^@0w' ~4#'w }4 @# !  c# #wwww@d\\@e+]  @(Ӏ @  \ |}4@Ow]  ?'Ӳ`_@*o^@_@] ] %_צ `Y@,@^)uv) h5 /@d/\/@dŐ@d$ `_@d] \@d]  @\@d/] ?@@e@d'`{_@d] ?@e@ku @d'] u _"@_]]q@u_W_Y"@qY@ q_߭}]?_] ]@d  G ] ?_ "@ _%'5 ]@#@d_\\`[@d\/`@ \ \` _*?_ o\ӂ(@@dN\\`@d[Z\`@e0t\`Z*?\]^ @?@t{howov@'_] ]o^@1']#]o\@@?"/@@? Z*`@ `2H\\ \@d @eM H  \ |4@O`ho\ @/9h^  ;%' # @]@+)] &@^`! #8]@t^`^`Y @ ` @X`@o "`^`Cv`hAq  "`v`ov`o o^`)a]@ O! o^`! #P]]   W@$\@s cX ] ^@c@(L  W@\@r)^! ]@f1!o #@/9@?H^  aiH"5#@]@ H ' #c`]]\@  X@@r )ch! ]]a@f^hkH%i#@] Hb)'' #p]][ oߔ Y#@]@`@ #'  #Hc]]@3ZhH5 cx]]Z  Z@')! @r ] #h]a@e^o %'! #P]]   W@\@rg cX ] ^@b@'  W@t\@rQ)! ^]@e!ovi@/8<@>^  bi@N H"%i#@] `H)'' #]][  \@B@r )ch! ]]a@ec^hi# @]`@ '  0c@]]@2ϐhX# cc]]Z  ]@))' @q! h]]a@e:^o 5#@]@ H9 ' #c]]\@ o [%'! #P]]   W@\@q̢ cX ] ^@b\@'  W@\@q)! ^]@d!oui@ &/7Ȉcؠ]^ @@h^@ @ '!]@&o] }/7خ<+~WO# t r~_^`8@ t~W)5<3_@ hl~W###~Ot[>O % cȂ@p@a#؈^@V @@@Fc(@!@@@)b^ >h"J`@X`@E ]\ @< @\@@%'^ov] ] @6Y@b@B ~_@q[`@`H5 &5l@`HcF0^@ Ȓ H\ hZ&ho']]  gX@@ @qLO5 o&>:`@ $e,p@O';'Oc][@ ] f^@@@@q< O5 o&!-'>W]Z@ e] @]@qo ] 5' d ]  Y@@@q5&o&@ ~/6@='`@^8)] `@%  >Д> " >rNl`s@cN@ ~@V' @K @<`rc(@$! >@g @ >$e@.@  @'% c] ]^@f k@q.hu  ' # ] ]\ @W j$e@q(phe ' c]]\@  i@FoN@$e8``@.o'$0``@ +0o'@d @$ 't`2H!  @H ! ?@  ~.o'!  &t>ђG@a>`.o'7 c]]\@ o h2`@q]o] )&t!]@`@ h @q]  @-  )`8! ] ] ]    h ^@]?<`t `&@4@^`O <` xx@@ '`0'] h'@1 c p]]  @\@lo`0@mf]o〤`o ]E㼠9 7#!'wa8w3 9 7&ahwϊ!@&www`3 9 7#`! w&`www3 9 7#aH!`(w&/1Ԯwwb_w3 woaX_]_5 ]]_ ]ww__]]_w]]_o %]a]] q@ 's@ ]v@ &p@b '] ]q@3   1']5$ )a8] q@ # `] q@ `] v !(a ]7&] v# caH]7#] v% &`]q@7 w_wgwW $wO;) 3 w wGw?w7w/w'w1) #w"7$;( )5)3 ww]wwwv_g___W8bP_OaPwgw__G_?_7!wW_/_' bwO!!pwGw?w7____w/w'a`#_cXwwwww____W_O_GaP!0]www_?]]_____]] ] ]r] ] ]s@ %]!8']] ] bP]r] 's@!vv@1 q@ 9&] v3 1 #!p5$]7$] v 1 !]7$] v 1) ]v7#w]ww9'ww%;) $3&wwwwww )9#w"7('5';% (]wwwwowgw_q@_߂w__ϰ#__ w__Hw϶a_wa"w__wbXw__waw_`Pw_o_ www `w__w_gwo]]_w__]`_wa]`__o]wg]]w__g $]__c ]] 'q@ ؊ ]v %p@a@ (] ]q@)`1']5' #9$b] q@' &aH] q@) #c]q@3$a]t $b]3)bX] v@ &c]3'a] v@ )``]q@3&wWwO (7$wG3) (w?w7w/w'www &7%w %w"'1#5)9&3'w]wwwwv_W_Oaȸ_G_?wWwO_7_/_'`Hcx_!"wG`Xw?w7w/w'____wbbxha_w#wwww__c_h_]`#h!0 &wwwwךc_7_/_____] q@]"&]] ']a]] ]q@](]] % 'a8"X] )q@ H] (c] q@ $vcxp@] 1#q@5) '(b9'] 'w@#8;)b] $`X] q@;&`h] (bx] q@#;%b0a]w@ #w]ww7%1&w3( $w %wwwwww7(1'ww!5%)3$9$ %]wowgw_wWwOv__ǂpbw____w_"#@ax!wwww____w` _w`ظb`#wwww_o_g___Www!ᰲc _Owocwgw_wWwO1"__]_o]_g]__]_W_O] ] ]s@])#"a] ] s@])# p``] ] s@###"b] ] s@ (%$c@#] #s@(] w@ %];'` ] w@`];&b] w@;(v@c]] ]w@v 1(v@;# ` b]]]]vq@?@@>@@?A@@D@@@M v@z4@^@` v@z4@Z@@0@:`@C@@=@@Y@@F>@Y: @>@: @F>@Zc: B@=d@@N@@@@ &/.Ȉc]\ @\@ H@h: @X? "@@@=h@    B@^/.\ A @Xb ^  @`"H` v`v`vF`vF`v ^` v0^ `\ 2H^`0!%!@]\ @0\@ H ^`0vP<^`( v(^`hv8^@v@^`vH^`@vX^`Pv`` "@g^H("@^8H #"@&^# @] `@ 'h^ `hW  #]]Z@#j @!)@g`! ]3<a @@Z^ Xo&hv%!] \ @\@ (H.  &c]\ @\@ 2H  /@Y ?%"] \ @@]\@$h]\*@^ X@ \^ X@h`` `? `?"H )] @`@ %#`]\ @\@vph a@h]o%#!' #]] ^ #k@1@g^ Xhϰ Ol#^  &hv 8^ 8vpv @ov 8&ho "@M^HD0 OU#^? #v^`($or&h "o&h`P2Ok&h^  @"Of&h# c`&h]\ @<\@?4 )v(!vp]`OO% x@h]  $OG%@?d^p !@hw] o>%O#^&ho5 &hvvP/@Xj T`T`@=!$!]\*@^ `\^ `@ @#H :  3'c] ]\ ot?,# @vp] `$H>  ' #a]][ @#i@fo)a ]^ Xa@Yh' ^`(ch ##v`(و  , : ^`(&o,o,#' c!]  ]^@o7#h&hô@2t oX@;%9 b@7$!/, '1 X" !]a]]]]]vp@w@@ /,߮ᨈ"%]F`?&( @XC @  \  @ $\  @) H4)] 4@#  h*&: aF]D \ @g\ o F@X "H h$\  @ $\  #)  H #)a]@`$Oܠ % : o܂@ /,\b `H]^ `?^ ?Y`8Y H & /+r"] aǺ?@V`@B`@" ' #a] #]@ ^D@f}^`8HG' c!]  ] \@ #@VpB^`8@fkh6\ Fw\ bw\ @Ww)]@ $O܀ Fؓ?`]D \ @g"\ oр\ Fw\ b'wה\ @Ww)] @`O Foa9#;%!@ &c'b8 &a`"p#3%c/+w(ap`w%b1%w)`]w(a( w$b7'w]] _߶&5#`P]]_״(]w]] ]_Ϟ`%]b8]]__w]]_%]`p]_]w__])] `(] h%] `r@ 's@#]v]vw ( $1&v@$;'"a bh`H] ]]]]r@rt@tu@rvq (@V@ZZ R Z Z  rr r r 2 @ #/*㼈!';&5(cpa`] #9)3'1)a(!ز` ]]]7'&( ]]]] hb"]]] ] tt@w@qp@v@/*^@;6 &b0]\ @^ `@Z\@ #" &`h]\@ @@Z\@@v`x&`@v` @9 ?@ :  @9n<@U 4H&`@U{0 '/*c]\ @@Z\@ "Hf %!]\ @@Z\@ 8hX w^ "1&^"1&^ " 1&^ + :`-@!^ *?^1&"0]\ @@Zj\@_瀠@ h "0] \ @@Z\\@wh( )`;`SOݠ L H^ *^@U瀢 @_.0 ow ' c] ] Z @ ޔ P&@d] @ &/)cؠ]^ @@Z^@ @&#]@ ] o  Н#/)ծ`@]w|^`8@`@p@-# 3w| %v@|%#r  9r<< $@|'u#<^@|@<r@@;\|%! @v@@Z|# ` ?[@ €{`<X@`%'; #c]] ?]@@3 `(@`] 4Hu &u@9@P[9?\@@`hp@ &И^^ [@_[8Ĕ] @@ E^Z@^ *\8\ć @/ 'a]`@'`O ' c0#] ] ?\@1 E_ (@a!]o' (]  ][@@v?  (^ `[]@a]o) #o# 1' #o[@ @o ' #] ] ?]@R' (@`] O o&@`$O9' ]] ?@:^@`9o{@; 3'bOrco] b] ]Z @$?@`o\`(@ H+o+ `P]] ?@\@_`H h& #] ?] [@ @_^ `H  h&@+Ft oi@/%l^@ 'Ѐ@% `@&a ] \ @@U1\@ 2H!(!]\ @% @U!\@ 2H &b@]\ @% @U\@ 2H&% c]\ @@U\@ 2H^@@&% "@` @~(] \*@@T\@% F@\`(]\€k  p]\@@M '^ ^Z8Yc "@/ 5)]`4@'`$HR '5 #P]] ?[@@`1 D \@ (@_]h@3 #cH]] Z @P? ^ `(\@_]o1'#@#]] ?@?\@ `(@_] `H h&! c#8]] ^ ?@*@^o #`P]]Z@? o% ]t0/$!ww ' &Ђc` `A`?^`8"A3'"Ɓ;'";'Ao "@a @D)  ] Y@A)&b0] \ @@T8\@  ' @ϑ: @O @ '%)] `@'  ]  x\@] @&碒 2@z7'^ (@ߢ 2@o;'^ (_@_ߢ @Q!' _ߒ @ `3'@ܔ H _߸]4@'_ _  ]u& h;& @ ow@sow c] ?]@{\ (@_]o_ c#]  ]?@k\@ `(@^2] O_߂ o$ #]]Z @W?@N!@oB `(<`]@^o9 co#% o ]]Z@? @7! @5 (]@^͘of  #] ?Z@]@" @5ސ# @M`(@oB@]]H `Ox_߀ od`o` !'㨶#]][@ @?  (@]] o瀤 #]] ?@^@ `(@]]H `H d`h$`Ho 5') #]][ ?@7 (@]]H`O値ht`Hqoߤ ;'9 c#]]\ ?@  (@]|] O_ߐ o&5') #]][ @? `(@]f] H`O) oo``G) O_o&`' cc]]Z ?@~)  (@]D] o9 co#x) c#p]]^ ?o) ''% oh ' #X] ]Z@? @Y) `(@] ]o_@/"^ & `@`?^`8@' '@&ВK 2H  `@ H`H  h & @x  ]@Xw7)]`@@'`@, '$_*(h 1 '3 c] wZ]  ?@9  (@\] H @`Hހ  d`h$@`H׀ o  x@L]h #c0]] ?@^ G (@]]oȖ$ c#]  ]Z@Ԕ? `(_@]n]o9'1 ##]] [ @”? (@\] HO hH o  ' #c]] ?@^ (@\m] HO h{Hx o ' #] ] ?_@@9  (@\Q] Hc ha&# #cx]][@ @w?  (@\=] HO hM& #cp]] ?_@b3 `(@\*]`H< h:& '! ##h]] [ @O? (@\]  H( h&&;'9 c#`]] ?\@@:!  (]@\`H h& ' #X] ]Z@?@&  `(]@[0/!,(ww' c#`  A`?^`8@ 'ccx@ڐ&В "@ `@%  ] €t)a]`@x '`@d'\@K纒 @X^ (@ߺ @M_^ (@_ߺ @*@ "H_`@'_ _ъ@hw@ow9  ]] ?@[@ (@\P]o_ ' #c]][ @?@Kn@m%B `(?`] @[c@`O_߂ o$@'9 o#!'7 #o߈ c#P]  ] [@~? D `(@\]o #] ]Z @m? (\@\] o{ ' ##]]\ ?@Z (@[!] `O_߸ o&' #`]] ?_@D% (]@[  H `Op%  % od`o``Gf% Od_oـ`' #]][ ?@ %  (@Z] o9'3 #cp]]_@ ?o% %'# och ' #X] ]Z@? @% `(@Z]o/_ߊ]t& & @ ' #/ d` ?' c P & h& ]]@[@ZH  h&]]@Y@@Z@ ?/Ѯ㼒 /@J (b]\ @@"\@ Hn1/@w&J `0 @JC] `? @JM)!] @`@% ' @!@ @ '83`hM>` #@]]Z @|? `(< @ZA]`O8 o&` #8]] ?^@e!  ( @Z] o ' # ]  ]?^@Q! @J@kB (]@Z``H   h &`?@IВo)``/^@\` @H!&%cH]\ @@Ox\@ H!&@ ’ @e!&#] \ @@Oe\@ H '%)]\ @\@h^2 a]\ @@!A\@ `@ '^` &Y2p ~4@ h@&]\ @@O*\@ H<(`8] \ @<@!<\@h@ o( &Y^`3  z@Y h   &Y^`1p  @Nyt  '/c]\ @@N\@ H խhg  `] ]^ `@Hۤ  % @I  @@I5@ @I  O%*%ۀ H%#@]`@$'!&"]\*@^ `\^ `@n`@<`@Ip3'bP]\ @}\@h6  `]  Z@] @'   )! ]]^ X!@KJ o!&0 '/| c]\ @@Nd\@ H @th9  `] ]^`8@Hr % @I` 6@@H@  @I!` O%   @L @@I < !'"P]\ @\@6 /@$ )"$c /*p`0 \@($p` @``` '''˒'''''@ڊπ @\ [@  @ h> @> h@o]@d]$@IH)0u@ "> H$oot@/@#Ĩ"))p/Z'a ` }4`?˔ @J'˰ "H\ ˒π @\ [`@  @ h> @> h'w'@wo]@If` @] H9 ot@^/l^ @;")0\@) '@ ˰ @  \ \`@ @h->  @ h(> 'ϐo@n'o$ `0] o] @ߠ$p$@Hđ(pt\o "> H $ot@oΠ@#Dv oĢ@^  A@Hr @: hvv  # w rw u ^ !@_@ @0E@_@@U?%, -@,s_#E@g@H:?@q_##%ˠ@`@W @G?@G+0@@G@;`@N @*@2@E@@GK`@`@G "׬" ?]uoϬ`_+hR%E@@N G`_ Oo`# != 40 Y` o ] !  q`ou ˈ@Y1!@@N?E@@Nz\o @G`O_@G G%@F` G@F G@@F "Oy%h_`#0^@/M\ ĀC A)0\@*)# @`@9뀣@5@X "@]`@ `@h'$@Ւh#@o@Bh$ `0] ] @Ƴ$@G)pt `"$ot@"t o: @"" )pZ ''ww@ء@ˀ @ \  Z @ @ @h\ @؍'o\  F@@Gɱ> @UF@@;'9 b7$ / '1 !0  ]`]]]]]vp@w@@ '/߮┐# ]Z@] @l `@V4^`  H &@ '/Ʈ0# ]Z@] @S `@V^`  H &@ '/̐# ]Z@] @: `@V^`  H &/0^^ ŁD   $  @ @(@ )"p] \ @@KX\@'H] \ @ @KK\@ 2H,^@` @# d &Y_20 {@  #` @]`OȐ$b]\*@@K%\@ o $O߰ o &Y  @E@\\\ @F  "@ \ ? H #] @ @"#@] `$O &Y' c!]  Z]@ @Tt  )a! ]]!@G\ o &Y@E\ 9# @] `@c&0] \ @@J\@ @]  H'!( ]\ @@J\@ ("h]\ @@J\@@,ܐ)  ] ]!@Gw@yd "@!` Ob #'#@$]`H -$]\ @@J\@@7 HX` `hSf` od`@S)a  !]!!]] @G=\ o&@  Oc#&c]\ @@JX\@ OR #] \ @@JJ\@@p oAd`  Oo'#' ca]]^  @ٰ @To @ $v o2 @/^ AA a]`@5`-%^ 8(] @,Z#'!$c #@]] !Z@"]]"ƀ ^@D\ @ ^*^ @7C"^ 8X` &p`@s^ 8v 8^ o &! ]\ @@I\@ H$ ##@]@`@) &Y^`2 @ \@"~  hf`! a ! ] ]] a^@F^ o &Y @]`@(`@!) !  ]aЂ!] ]^^ @Fw;(`]\ @@I\@&] \ @@I\@&b] \ @@I\@!("h]\ @@Ix\@@!# &@,n`X`G &YM`l`r"@^^ @-'; `] #]@]@^ @S^o &Y@ @6 hood`@`]\ @@I:\@#  ' '- c]]Z@ ƒ @@S^ ^` &Y3 @\~4@v  @B  h>f` #!]  ]Zo ]Y@oZ`Gg ) ! ) ]a]!ؐa^ ]oY  Œ @_@- &Y^ @Se5 ^`  \@C|`"@ h @C  o$@v o@/[@^\.@D@\.Ѐ "@^hU \.@B .܈@ @D+0`>@B\.\.\.^@@B`H$3##@] @`4@!'@B^ov #] ][  @E@R" )a ]^a@Eho`@]@`O' # ] ] Z@ o  !'#] ][ @ @R^ ``/^@ \ @p&] \ @@H_\@ H!!'@ @)`] \ @\@h\2 1 &Y^`60 |t@ hQ "]\ @<`@+\@ 2O1 &Y'!]\ @@\@ @  &Y^`2p ~t@i h%(8]\ @@\@h &Y^`2p  @Hyt   f`@ &/kcؠ]^ @@G^@ @&#]_$] o` )/Id``^]\ @`\@ &c]\ @@G\@ H(!$' !]  ]Z@@D @R \ ^` &Y10 |@ @ '`P]\ @x\@  hֱf` ]\ @@q\@ &"]\*@\ Z\\ @?@}!&@ #]\ @@GX\@ H$ 'ax]\ @@A\@Z H H@@@0 '! c!]][@  @@Q\ (  8']''\ @@\@ @ 3'`P]\ @\@hW '#] ]Z@ oԒ @`O(' ca ]][ oĔ ' a]  ] [@ @AP@cB\ @QI^` &Y20 @~@&  @   'o'#'! c ]] Z #n@a @Q* &Y^`30  zt@  ' +<|9 #v|/!' t|w! s ) r|< +"|&#\|(|sY@|98@<q@)] ?`4G0`!+p% \ @%' ,] !p ][@  #`@]@  )!a ] ]! @B6'(] \ @@EX\@ ` `-']\ @:\@?@h @?`2H  `]] #@]@@Oh? ' #x] ,]\  @#`@] `G- +)a ]]@A h?%&,H] \ @@\@?r' ]][  @# @]`@ 1) ! a]]a@A@?%] o?u @&"H] \ @@\@?@ ' #h]  ] [oϔ @>頠@>o@@?S" O*&oڒ"H%') !X]] [@P #`@] `GC )a  ] o9 ' #P]]Z@ om : px*`O]  @U^@>@_B <@\@N\`  @F0 _"@  O o& O o׆oF0oA@ < e^@^@ ]@MH h&9 < d^]@@]@M`H &Т`/ഒ  ؐ@=T\` ? && &Y^`2 )ay4&0]\ @@C=\@3(cP&] \ @@C1\@H>%(cP]\ @@C#\@ ( HcP ' #] ] \@$F@McP]\ @@C \@3@"H ' c]  ] ^@$G@Mi @ h&o ]\ @@B\@ ` *0 % \ @@=L`/@' # ]  ]@r^@@M: /o %#(][@B!("h] \ @@B\@( ]0`^@Ā# @&v@˔HN HJ hH&' c(] ]  @9^@=@^B@L @  &ցh,mo"h%"]\ @@Bs\@!# @]@`@]%(h] \ @@Ba\@3< `) ' ##@] ]\@  @h]\ @@BH\@@L "@ O o& O o&h] \ @@B*\@: @is H' #H]  ]^ @@<@^?Boΐ' #8]  ] [@ ) 4`] ` `a@>Иo%('`]\*@!(@A\!(@"h]\ @@A\@8@<6`@h @'4@< h&| #0]]Z @r @<<@]B@L5  "@ `H &շo4 O o#@] @`@}3'%(h]\ @@A\@<0 ` ' #"]  ][@oA   @=g @R&@; kH,' c ] ]^@ @! @K "@`H &l!&"]\*@FUF\@?h & O o 7@; F0`@=3 6O!& '% #(]  ]Z@@ @;@]kB@Ko !'# b#]] ^ o ! c"]]Z@ @͒  ) ! "] ]a@= or%(3'# cbH]  ]Z@@ ]\ @@A\@ o%(h] \ @@@\@< @ ` '# #b0]  ]Z@o # @]`@! h]\ @@@\@:  @h" H|' c@] ]^ o #"8]]Z@ @f )  "]] @= oԊh%(h] \ @@@\@3< ` ' ##P] ]\@ oI %] \ @@@\@!# @] @ 'h] \ @@@}\@: @gƐ H 3'! c!]]^ oT  ##X]  ] @ [@)4`  ] `a@=-oԒh4\hD@  @:=? && &Y^`2 @ y4&x&0&@ '/ɮc]\ @:^`8@@\ H7 H3#(] \ @\ @ H$& '! c"P]] [ @ @:k@\"B@Jd @   &h&@ 2O0`/^` ^@뀢 @9')] `@)#(`] \ @@?\@ h#*0  !%\ @(]\ @@?\@ "H @a `"@x2H|@|2H`2H@9("h]\ @@?\@2 @;$F 2H$| 2H |@j& ]\ @@?m\@&] \ @: @?b\@: @;GF|`2H`2H@5!("h]\ @@?H\@2 @:F?@&"]\ @: 'F\@ H?@9 "@ H? &?h& O o? ("h] \ @@?\@2 @fo&`]\ @@?\@9&"]\ @: @>\@: @f{o|(bh]\ @@>\@2 @fsoc@oF| 2O;`2O7'#] \ @@>\@ "O)&0]\ @@>\@9## ] \ @@>\@ @e?  g  @ @HЀ"@^]@@H^@"g਀2OЀ 2O@h/!'3 #bx] $@ ][  @) # ]][@@#@ @H `"@  4O o& O o #b] ]#@[ oԔ @  "p@I]o^^`@@Ԓo&&|o&#(bh] \ @@>:\@ "~bh] \ @@>-\@ "*bh] \ @@> \@ ,*>x ot&|or&`@ ok&@d& ] \ @@>\@&]\ @: @=\@: @9 o&#@] @@$ '?@9&"]\ @: F\@?& `"@ H &h? O o #"h]  \]@d `] \ @@=\@')  "]] @:}o@^ `@H] o#( ' #X]]Z@ @9 @H &p Pp@%&/ $0]\ @@=j\@AJ"გ@@   zdyd@H|F@ `d!#$F@ `H$F@ `oF @`1!#$F@ `#``(p ha ]\ @@=7\@ 2O`^`p^`(@`)0 ``J@ 0]\ @@= \@h>o`# ]\ @@=\@ O$Fo^`p ## ] \ @ @=\ H$Fo@ H$Fo# ]\ @ @<\@ H $Fo@ G$F0 (/ zⰈ`w]w\ @@<\@$w߈`]\ @@<\@w@d9 / U /@7W Ţ # `xt]@ @,@\L`H ] Y H,@h +` @1#+#!)'' `@! wwײwϋ9 @`/ $@ "@ ,@` @-` O9 h   " &  _߰ ] w]☺`b"\@fL H_]Y@ @ #  $O\ /o,@@] @ @> ]\ @'\@! "G /@62@]# @]@ $Oܰ ]^ @Ɣ!) a "] ] @8 oʰ  !@^?@6~@X5B@Fv /h,@!]@^)a ]!!@8]o]LOo]oLL@ (/ Ԉ`]\ @@;\@ h  *0% Z@# ("x] \ @ٯ\@< @ @ # &hf&c`]\ @ٜ\@ &"0]\ @@;\@@` &&#] \ @ـ\@$`] \ @@;\@@`!' h/&!]\ @e\@ $a]\ @ @;j\@2o h@@2o ho#o#o#o#(o#0o#TT@/ ܮ8@- &c]\ @\@ Hi@5_@5M@5Ii@5F @7 @8 #$@*#@ @6w0` @5C<@5?h]3'! c"]]Z  @@EfhM ' #] ] [ o ' "]]\ o Ӟ`@]@ @'oĐ b]] Z@ @t   )"! ]]  @7o @@5f">`@4:o*{  "o7@ % / D؂#HH ]\ @@:\@ Hߒ d: w/ %\ H^`8 &x%#H]\ A@:r\@ H~ༀH5 ' %'%`) ?]%?'?aw"w^*ʀ^ ϊh@]H` !@ H  3`3` @+` +`  #h] H  !@H  3`3` +`+` @#h]  `H !@+p 2H1@h]@`2H@ !@@ H  3`3`+` +`@  h]@`2H@ !@@ H  22* * @ (p 2` sh] H  !@ H  3`3` +` @+` #_]&vv@`@G@E]< @ɺ@^^฀ @"7 `: vv@'@ 2OO^hhvȵ7 h=%_] \ @ׄ\@?@: ^Ș'vo@ ]"Z@]  @&"@3@UB@C H_ & _` @ Oŀ  o& O o !] ^ @I^@?@: '@ov_ ] Z ]@"@3@UmB@C O_ o&3%1'a#) ]]"ئ 7 \ @7 \@: ?@@ O7 h(] "@\@3@U:B@C| H_& _``@ H h & $H &h@ "O@/ H>6 !*% Z@' b]  ][$H@|@CE '#]] ^ o$I' b]  ][o$J '#]] ^ o$K' c]  ][o֔$LPxxȝ@'/3ᔔ# ] Z@] @,$M@B& "&]&\*@FgF\@ ?&&@'/ # ] Z@] @$M@B& "&]&\*@FAF\@ ?&&/`@=^ H^\ ttttt  Hܬ^ Xwϐv X^ hw@-( H"` ]`@  ] @B@2B@3 "H!# @ ؔ@By] @! @. @   ##9w## ww :`@@` ) O:`_v X _]v h@ @`@BH]ɭh|ߔ wǐ @1,`]] @ճ]@ @,)'] @!@c\v h@`@__ǔ @1ݪ O]@Bo@B] uo_@B]oސ_#]] !@3_@@1@SB@A@2 #]\ @i\@ @3'@1ok@1 c#]] !@\@1ؤ@SB@Aѐo@ St o@^  @ xt|t2@\`v v v ^ @\`v @I\`@1^ *\`h\`@I\@@I\`@1v  |4z@Oov @^/ܮ ^ `^ h\ @^ Hi @ @ # @]@`@'@  &b`@1@]v `i@7#`@]$H,#] ^ @^^ `@  2H,5'] ] \ @舔! @AQ`,`H v `i ~d@ @`@@ @^ ho #p@^]?@1} @G@@8@!#@] `$O, ' #] ] ! @O^@@, ) a ] ] !`@3po, ' #c] ! [@6] `c] @@o,@0G !'#x] ]Z@ @ @0@RB`oc ] ] Z@ @! @@ג`^`"?V9\ ?oO`@^ hoA@ Lt o8@/ƀv*v^N@ Y`H^ H #]]ƀ'c^"^ ]c\@  @&@ \\ *?\^*^hq ] @Ŕ! @@\"?^"ƀg ^ ]@@ZZ@ @V%#] Z" %#^\ @0[@ @$\*?^%#@]@ '^@C #]]Z@! @7) ^]]^ X@2o^?#`@] @ '*u" ^vh  cc]] !\@i#)a ]^ Xa@2\ o@0Q od`@/g @^  \ YI@@@ @GI\ @(^Z  ? @1 rr ^r v@Gj \  r ht ' c#]  ] Z@ @ !@?h ?o@^/$\ C\H\ @"  %`H]]@" \`\@\ @/Y "@\`\*?\@\`t t`\ \@ @G\`@/\ *]@ ``H \h\@ZJ@`2H \@&Oo[ @oޱd@ t o2 @^/Ԯ\ @d@^ H^`@d%`H^`@  ]`?^`^`@\@dp+]@ dpI\ @/\ "@@\*?\ \`"\``@ \`*^`^@*^`h=@0S r @G1\@t\`,@G* t ,:@8`o\`\ @/`!'# ] Z@]  @j!@?3@G(o"O\`\ ^ H o\`@ t o@^\ n^ ^`*@v^`*@v ^` *@v ^`(*@v ^`@*@v 0^`0"@^`Hv `8& (^`H"@`T^ 8O [` Y @`JY (*?Y s`(^`Hv 8`T& @`P& T`X`@:"@6Z)`\`@."@& P```@&"@& X`d`@"@& \`h`@"@& ``l`@"@& d`t`@"@& hhh& ho& do& `o& \o& X Po& Pov Hov H*?`Tos`(@ 1ot @/$ #`@]^ )` 8` -"@ @^ *?^h;`) 8` vO`  `# @(`9 `vO`o^ ;`@^ P\v P\  @   @.=^ P*?\h@.6o `` H Z H@@`` @^ X>@.*@-\ P@^``@.e^` "@1\ H\ P@ @^@t P^` % `i @-\ P*^` @@b \ Pv@@bt Pv`Āv`,e\ H\@v`\`v` \`v`(\`v`0\` hv`8@-oܐ`^`r^` r ^`(r ^`0r ^`8Ār ,@/@p@^ hM @\``@ `@+t``^`"@5,^@L.@@-@-?t`h\`hI@@ t`h) \`h+^` dh,L "O\`ho ' #c]]Z@!@ @=@.t`ht``2 0/4bDwߔ@.w )`x]@`H @ h&@@-` O?^/ܮ\ ā (bh]\ @ @3 \@ $  أxd@- ?' w @'^  X@' xH)`'c] \ @@2\ƀ H!&"0]\ @@2\&#]\ @@2\ H€`H7#(]\*@^ `в\^ ` @ '2 H (] \ @ Р\^ ` @ ' @e '`H w7wwwwww@-w"G@-  @ h' 4@- @"'@,` @ #`@] @u '##`] ]Z@!$@ @,@NB@<hb'`]  ][@ !#@,Ӣ@NB@<̐&] \*@GAG\@?'^` @  h;' 7cx]][@ @ @,@NdB@<^o耤`(] \*@^ `\^ `og @ H`oT@&oB#П@ H !&o/"0@t o㾐 )/ɮl``]\ @\@I+(a]\ @ @1\@ 2H  &a ]\ @@1\@ H) )]`@x`"H(!'#]\ @@1\@ "H&c]\ @@1\@ 2H "@^ @`2@^?@F @!-&4`2@w]\ @@1\@ H$-& &"@]\ @@1\@ H-&^ `H!%!@]\ @f\@ "@%)-&]\*@FXF\@?&^ \ @ @"HW^!&#]\ @@1S\@ 2HI^+&b@] \ @@1E\@ 2H;^ 2H8^( ]\ @@14\@$w] \ @@1(\@ # @w]@`@Q@+ & ]\ @@1\@?@>0: @X^ X<@>*?^F0 @Q^@ 2H &`@!$Ab ' P]\ @\@hV"]O')# 8]  ]\@℔!^ XH@ H] @;F" ]o$'c 0]]!&\@l o@y?@u^ X)J@ ]H `]@-ox] `@( ]\ @@0\@`Fx]D o${x F7wwwwwww@+y ox 2O4'c]\ @@0w\@ "O4-&]\ @@0h\@ 2O4+&b0]\ @^@0Z\@"`T^  2HP^ Ѐ2HL^ b0] \ @^@0E\@h6!'# ]  ]Z @#]]  !@\@:^ X'\ !@]b0] \ @@0\@@E@B^@:^ Xol4 # ]][@ o͔ `\ 2O_4 )a8]\*@FF\@ GO#a]\ @\@!$ ] \ @@/\@g7'+#`(]  ]!%@v\@:?^ Xo+4oU-& Z@)p  S 2O o&@^  ^ X@:] ox '# ]  ]Z@N#v^ XH@`H] @:%$] $0/V@^ [`H `\ "H `h)`x]@`@#`h'H!#]\ @a\@w\`_\ H h%''3#`@]@!'h #@]  ] [@!.@7\@)Z` Z]!X@@,\`Xhe ]`@K] @HY ("x]\ @ \@3< "@`H+0"@ `H@  "@`h: H)%)]G\`X P@:S]h* a]@`$@$ 1\`X X@:F] h "G`H oڀ?@< H]@)@V? H o&o&   /@P@㾠/@V @֒O @MN@)E@(@(c@h? 8' ] `h][ @P#w )! ] `p]@+sh% @(Ő#4@!'N@H o#h]  ] [@/#w )! `] ]@+Sah @);   @)@@(@r @) @ < @ `? < @ `?   ZZ   @)/`!^ ]@ H @g@9z]Z Z PZ 0Z @B ` r r " " r r (rr hr   xd5(;$ $`9$c`3&!x1'a7("&p (bH 8%/,b] w%bx]w$]a] ]w_]](_]]c%w_]']bx]w_]_]%] %] ap &] !@r(#(cx] ] rb%'b] ] r(r]] vr ']s@vw"@%;5%b`д]u@ )9'31#bh `#]]]7'#]]]]ؚc ]]] ] trtt@w@qp@v@ A@@TҞ@@ @@(H@ ~`/@Z #`]\ @@-Y\@ &! ]\ @@-L\@ 2H! "@ &] \ @@-<\@ 2H &"@] \ @@-.\@ H% %] \ @\?@5   `?wwH*w'a0]\ @\@&] \ @C\@'b] \ @8\@ Hc6 f H\ # @]@?!' `?H*( 'b]\ @\@$" ]\ @\@%@] \ @\@( ] \ @\@h#] ] Z@!=@4 ) $ ] !]@)W\Xo@  ~~d/ ,@@  &b0]\ @@,h\@#c`]\ @L\@)a] @X+#b]\ @@,J\ @-&]\ @.\@ !&!0]\ @"\@))!]\ @\@ b]\ @@,\@]\ @\@!]\ @\@h6 @)#@&`]@79o+#@`/~\` ^2 @H!&%cH]\ @@+\@ H!&  @~!&#] \ @@+\@ H)'%)]\ @\@hw2 !]\ AWw\_@ @  ^`5 &Y6} hY &"0]\ @@+\@`@(p] \ @@+y\@*0 @ h #!# @]@ @ ' @&sĀ%a;w]e_\ @< D\_@@:$ @%'&]\ @@+@\@ "H) &YQ_%( 8'] \ @=#=\@_h^`50 @zs O%( o''_]]  @ܳ\@%}@G4B@5v`@`O o'o@%g $"! @%] o'#]]Z@!? @܉;)+$a @ a ] ]@'oj `@]@ @A;'#' c]\ @ȳ\_@ ?`!'%!]\ @_ȣ\_ @  Ge!'#] ][ @J @%@FB@5 `@`ON'&o o+ca ]  ] \!@@+!$@  )! ! ]] !@'Lo##`@] `$O('& ' #a]]]@ !>@ ))! ]%$# a]]@',o'&wo &Y^`3  z㞒 h   &Y^`1p  㓕yt @/ɮ( ##` H: ]\@ @\@@?)2p!h a] @(]@5W\X< @&/px %] cp@ @!0#"] @% @%)` @W] h] @%]o#@ #/ЮĈb @%] & H#x)] `@@%D !8@5 ] o]#@@ '/<`(]D ;5|-r%^`8@/t#[<%aPaX|Ц|c(|q@a`!@^@@ @s`@{@!^@'X@`]| @ )@ ` @ *o @]^@ @9P^@C@@@@^ov)']# ] \@@;|@#@EnB^@3@ ^F0⎒  H, h*&-o^B@@o+%'|]\[] @ e@3 h& ']# ] Z@ d@ڲ @3{&0'/C\^8`@P#)a] @`@>3`@@ ` !@] @ )@`@ *o @ w'Nl`s@ @i뀢 @ $e.ߔ@  @5a] `$@/ @2Kax@4] h% @'.  Oߐh@2:p] @3o)!]@`@h  @2& h@3] @/֮ᨠ   ^ ` `4`@kv`10  !H])0  ;  o$ ?` & &@ /` 9 1p ;aH ])0 > @ o# @/a ]!@`H]@#L@$b$ $ @# @  t @$`?@! @$  $@@! hdg@"b\ ot @"]o @"? @1"@"@.耡 H* ``&``H" @8`` @`   C`` /p7 @  /p H @ hxth o Z  )p`   @ @ *o @\/X\`@ \Xa\ P]@$^jH  H @ t`o@0^jP@  ^ Y`Y  `'Y@*Y` @"  @"ے t @". \  " ^jP @hvjPX@"@ q@Y  hq@@!@#@@#@*0 @ )/``]^`8\ @ H\@Ģ&c] \ @@'K\@ HK!)!x]\ @@'>\@# @] @`@ 'N`@{%] \ @\@ @Z'&]\ @ \@ H'!% '#a] ] ^  @ذ @1x^` &Y0p \|U @z' P]\ @\@hn!]\ @\@ 6O^`1'#]]Z@  @} @!G@BB@1>o^` ca]]  [@@g @!1@BBo '#]]^  @S @1o^`!c!]] Z @F @0#)! ] @#i!oaN '#] ]Z@#U @. @0o2 @-#/L@]`H#%a]\ @]\@(x] \ @R\@')% ] ] 2 @#*)$ X]_ @<_@1'!]_ @1_@& ]]% & )] bp \ @z\@"`]]_ @n_@]Z ?'%]_ @ @&_ @#] _ @T_@@!s $b]\ @C\@ %"8]\ @7\@#%`]Z@Q'%] \ @\@`*00]<00[@@(]\ @\@u' H]\ @\@ @]H& ) '! c]] ] ! !-@I_@t]\ @Ç\@@"f'%o5'%] ][!,@* @/@h'3ca]]] !,@@/_ @ɸ_@2oA]"?K'%`@(H``@#$c0] \@+'a`]\ @ɚ\@c0]Y@@#%`]\ƀ'%]\*@Ɂ\@@?`,00]8p0[@]`@X ']\ @Li\ H@]@@(p]\ @W\@a`u]\ @L\@@=@;%'!]][@ @֕!+@a`] \ @1\@ )! !]]@!o(@ HF@o]#ca]]\ @k @.Ha`] \ @\@) ]@!!o'%oq@$+'oTa`( ]\ @@$\ @#$o?c0 ] \*@@$\o p #(/X`pc] ] ?""@_ ȴ   ] Ț ? `14$ c ] #?R @(c]@@`@aH 9`#X]K@  @ < @ ]T @ @]R @`-< @]Q@ `@ #: .\ H4 !*#P% Z@@ "*<`x@] +T $c`]`  $tTT@ H ! > b]U@ @ @ !] @o\S#P]oXS@ .`?o".'#] ] !A@[^@o@\oD\ @woD\o\ 6* o@o6*\@\o*o o\o *\@\ow*o `@A#`@6( ]?V @   @ < b@]R @ `oThZ cP]R &@ O󀤀 @ )] [othF O値o: c]@`G?o!@  pc] ]`@`#o`cP] U@ @?G G(c]@ H#)?!@b]f`[ot 2O o`$@o @$@o' @1]@@4@@@@@@ @*@p`Z*xs`Z*x^ v`h(r*O 'Z**@ p`Z* Z**@p`Z*xq Z*xq Z*xr`v`hr**p`Z*xq`oZ**@ p`Z**@p`Z*xrZ*xp`Z*x[ v`r*@/h!#p]bH[ܤ#@ ) ')! c] ] ]\ (* 1\ \ \ & \ t (1\ (" @ ] \ (t (J`'"@\ (H倠`:`""@\ (@`#`@`  \ 2 @2`t (ot (h!"@n\ (J <"@EJ  @> H ?H "@*_@ @]\ b@] 2H\ n`2@1hڰ!a"h\ @T]hӰ!un`@-h̰!a\ @F]hŰ!'☒ ]@!T!Dn@)ה`\ (ht (`<2O " ] @t (\ (t ( - :`"' `?`?"H `t (:`ch<@] @2@-+"\ (@{]\ (@t (H@ >@%I` >@`_@x ]!S@Ͱ!Dn@)`hw\ t (un`@hn!a\ @]hg!_@bp ]o!R $nt (n "HZ! "Xc@] a@] hP! +`"<t (: ]@F "@ -\ un`"H<!#aopbh_@` ]o#@$`:@`\2G0\ (`t (I` O) n o$n`+2O#\ (`t (n@h!Pc@a] @]h!`t (n@ah!]@]!@ / "@S @] "b`H%]@!) ! @] (! ]b#]@\]b" ] ] @̔h,> !)! @.]o (@E]' bȒ !U@ &Ḓ@8]@h> ]]@[@ǰ@:~B@( @ )/pbw]@@/@/w ). b&.]@: &./@Z wwwwwߐ $.@S$. >` ' #!VbЀ`H ]]@ϩ[@(r@^I@ @`?`?@@"  @ "@// @ .>  @`:@ / @/``2O// hso?@ &/C|a]@/7Lcpw]$ ww'wt,w瀠t`?@^ ( @ +`: ` @ @ @@2\ .`:`+``H:@"@`,` @+`< ` @ @ Oh,h 8``\@@ *, @@< H? 8@,o @o`,t(: @/ޮY. H2@˃@V*08@~8p8. H. * @*@u@ @'h b ]  Z] @ߔ!M @' hA o$*@] @ao@#/Ĉc]Y@ @ #b]\*@\@h>^ h: @h#` "2`"] \ @\@ c\]^ ` 'h> #c]] ?^@΀ ?@\@^@'@@?o"@#/h @'`8]c@  $`H ] ] @YY@) `] ] \ X@|  ~`'/~Ј]Z & H] ]@\@@*ht@`1`8 #4 #] ]@ɖ @kt@%b]\ @l\ @Hm3!&#]\ʀ 5)]@`@c\X@'] \tX /@\t`  \t`  www͔ @( ] \ @1\@h7\\X@0Z`H] ]^wg \ 8'o@Ho(Bo(@ '#"] @]  @Ͱ\ @y@80B\@@&r '0ww`/Ԯ(\`   ؐ @^%w &Y^`30   zt ''''''?@\`8]\@@97#H]]]@]` ] Z @.#&] \ @@\@_ H #)&`H!]]@\@*ht@7`9`8]#ؑ6]]@ @}t@#"(]\ @\ @ ?@5'#@] @`@9' & #' ]\ @@x\@_ Hd @^`P"Z_@L__@O_`@71( 8]\ @_Q\___@ hO]\@1(_g 8h ''!##]]_ *@ @%O1( o'##]  ?]@[@@V\@@%oG?u O o'_._oG 'cc]  Hcw]?\]@403@`#w1_?] 103c# @4``@t "@]@@ @a_@$@@ow]@_&_]\`@G?]@@w]<`G@z_?`$@_w_ w 2O]oS@'`O_]  @R] @@6B@%G? "H' 4O'  'o'  H_ '_\' '@ $@ ow]_@  )@# @$o']_@ o (7#]] ?]@@%]@\) `] ]a@.o &@`@$ ';#c]  &]@^@@6pB@$G? Ӓ  "H' 4H16  'h-6 +'%c]][ %@̒ @$oG?@ 'c @]  ] "  @˺^@@@6;B\@o̐c]@J_@t@oה  "@'@  # @]@`@5'! `]  Q][@ɴ @v)(a "] ]\Xa@Ӓ ̬ 7 ۠~Ӵ@@ "@);r@@~'@v!w@~)!r>7(w@@5 w@[~(5жvZ%#@~br#Z@~ `h>r[@ ! @~r@@^">s@~@p@~ې`@5h]&@H-0 Ā !?>Ӏ`?@ "H&@ Z@{&@Ǡ@\] `@^]&Yj n `">~Z@Z]] R[@ @>@ZX@] ] a@\X<`~ Z s)p\\@[* @! o\G?^@z/ H '`"@)'h[0`7#p]]  S@ȿ\@!\Xo o'@X@] @ 4O]oZ@@g ~&@X@`@ oo @~ג $@@M G~YoL4` 7- נ&@ 8 8?t o30  /`췤  @ &Y^`&3p@ ? ؊ z]  '''?'''\ @@\@ HM@f`@8^`8!&"0]\ @@\@#@]@ @ '#`]  U] @!\c@0p )( ] b]a@?(8]\ @'Yh"\'c x]  Z]@ T@ ƒo( `P(p]www\nwtn]otn@ |  <Т<#(<^@ @@@ @!@@^@^` @^`@@ov` ^b  h&`&`@(/MT#6p])0`H  @ h   H  `? H '#]  V [@ǃ]4 @ Khg @`@ go@o : 0/l^ @!'X@@#X` 'c X (] bY +`:-@! Y *?Y!'#]^ @@^@ H,%&0]^ @@^@#h1p *`: SOݰ N`HY *@X@@瀢 "@ h _ P\@]]@_@ h^ 2H ^ 4H^ &^v Z   @R@@/|/@sƀv@ٰ  ' # qb8 H  ]]Y@@ذ @^ '/خ\ 6  "Ƃ-^  H   "H  T`2H  \2H  ] "H## ##^@b]\ _@\ @ @ )\*?\  @ؐZ`?^`@^ XϬ TH ` XH`^\Z \`@"@ ' @ H`' c!x] ]Z@ ~@j  @2'`@??`$ H ! '^ H?$`@ nЖt r` @- @`@`"H<` T @ \`"H _@@nz4'<`@@0w @@@#@] 4@-'@ @?@ ' `L@S`HK`@#' c!]  ]@_@ @_@^^ 2^`Z @ c)c!`]] ^ |@ 1) @;ah@&^`! ]]@!'  `hCf`] ap  }] @^^` @\@o'v o͠".@h* '+ca] ] @ŭ\@@v_@^^ '^`^ @\@` |] @ś)!h@c @%^`)] ]@ah \@!p ]@ň }^` @O[@h v oؠ9#!]]   @t\@_@@:o^5] ]  @d]@@A)@! `]!@_@o?@) '!#"]]  ]@H @@/B_@@ hߘ@y_@o? ߖ@_@o '5#] ]  @#\@@ @/B _@@@ ^^ +^`^ ̀' |a`\@] @  7 @кh@%'^`)] ]@+a@/G@-Ghj  p }\@@]^`[@ o:v oԠ '#ca]]  @\@@_@oo|! @@߀ Oo7'5]]  @\@@ @/HB_@@@ Yo^^^ ^`]` ';'9c!`]]^o |c!p] Z@] o v o o]Y Y`}Հ oҸ  t oʨ@/ H!  b]Y@Y@@Y@ ? @"Y  ?d` H <`(] h] oZ@<`@`/e ^@Y @ @8@W @\ \@ @"@ H ''b]]^@  @/\8\ X@@\h6 #] ] [ o   @  Oh$5'1"]][ @  \8\ Z@[@ &Y^`30 zt˯ h   &Y^`1p oyt ~/l:! &Y  @ ?^`40@ z4? 4" "?''w H'? t@H ;#`@]@`@) ^  ]Za]Ll^@^`8  ?̠$c(???`Hu! 1 ?ؠ?Жs  @G @Y@tY@@ZLl r@>B ϗ2@X@p_ O?+ @  ?@ H  #? `?Hl  " hc? &Y^`0p @ }  oڐ `H ?В;!?װ?v?ג Y@ o ?̚o#@ ?̐@ G G?Ȑ!@@&?q  Om?o+ Ll s@@ G$e,p@@o @ΐ Oo~+ # :`@ɝ d``d`: @/l: \  ? @\  ? 2 @   rLl`s@ `r@]`v@V x@KX H # > إ,0]t@ @]@ @ 9 ] >?* t@ O^  >\,t@\  ?@3`\I`-@ >)pt@\  ?>,0ht@@  @ R0` ]@ \@ #\too\>Б*p]ot@ `]or  ] r Ln@   9" ] ]:@  t`! ]@   @'\ 耢"Ox "`] :] @ Ɛ>*poxt@ @ g74  ]]@ >)0ot@ "0] ] @ >*0ot@bH] r TH   bP]r \ H >"X+0] t@ H >b`,0]t@"\N "H\>bh/0]:`t@ *`t@\ €"H  >"x.] t@  "Ox>b*0]ot@b"p]]@ R>+ot@ '#b@]]Z@ r@ǒ @^ P^/ɮw \\ @\ @:@ F`F@@ʔ  @ ' @רG`X2HF@ !aw'!#w! _'/www@- @/`"@F@^ Y 8ʀn &Y_730 `i!# @]`@K!'֔` "`@_)@ @,^ ^Y 8x 2H] 8@'] 8"`\]@oːu 8ot_# ]  t]@N]@@*@ _o] 8#'_c]] w_@; @ ̐hhF@_7 $f@ ow7_#]] [@( u@^[`)Y@! ]Z!@ H] o_7# @] `@'] 8tou 8_# ] v]@Y@@)^ ] Y !\] @ $Y@o] 8-'_']]  t@]@Ǥ@ __hF@#`]]Z@ s@ؒ o0%t oF@@ _^`8^/ήĦ ^ @Y@ F`F@@֔  @E ' @ F@\[8@ HJ@%@ ]h?`XO#`{@G{ Gwww@\w`@ @\] O{o@8?G__o#`]]Z@ s@h ov o@/h,@ F` F@a(@ ]!''!8]]  I\@EW_G Osǂ?ssssϐ7/@  @ 7@ y]@,\@ @@ڐhϐ3);a3[] K-0 )0 +0 SC@ `@ \ \`(N@l d\0\(t0t( H(t w'\_ '@@ޒ @r_\ 8@##`@] @N _')\ K]@t @@h '@mw'3$b] @ȵ @)_Y 8`@_'\ K@@ ot X]]  [@#}@_'@3L)! ]@ Аo_'@"  ` ow'] !P]#|[@@ @n_'@J@) ] @ o_'@ ` ow'@@@!H@]oY '#0] ]Z@ x@\ @9@і0/[ ^ P Z '@-^ X`@ { X`8€`"@f!'@lF X @M '?F \& X@) ?"@0!'逤f`"]Y@"`^X@@2o^ @q ?"& X] ]vu] HW& b(]hR$@^ P@o#]  ] [ @ @@)uB@o#a]  ]@\ @@)aB@o?#]  ] [ @̨  @o  o^  '#a]]Z@ @ om< ~/h'∪]^ 8X@Z !"] Y@A; "]\ ]\* Z P Zt]\rh2t%`(]Z \\ @r @;)\*?\  @| @[  w  !"" ]] @ H1MnYN `?`? 2H#`X"H"1#"] @ @  "] `@"]@o@ @Ԓ `@߀ @'@$`X" `@@D`X @O]"[]t@' s"@] 8@X@t`P@q]n 4ߖ@ ?'@ "" @%8 @ $`\G@+@h '#]]  @\@@(jB`\@@G@D`X$`X@uh @@ o˚ '+#a] ]  @\@`H)\! ]@ @@G@G@No@z@(1Bo#]  Z]@ @k@("B\@do;''c]]]@ @ @V\o`o]@ 2G\\\*?Z PoZ P@| @'\\*?Z Poܬ a]  ]@f]\@.] h   @ #@ r`@ o" /ᝠ @#)a0]@w_ך = + +  wא@鈀H+9鰴0`&w]@!7#3'@-c]]" D @\`@ @0_@`4@]\@  *o]9"]@hV@c#c@]hM  @^@@Ѡ) ]\`!@]o\@++@`wז \` w[I @ +@ I``O +@[  ?` `+@w\`"?\@@׀ "G9\ ?o\@ '#b]]Z@ @ @y 0 )/STa0]@-?5]@@'u`'M@`@d( @,  @(`= D@`M` :@ `]) @q@/] L` @i@,,c t ) ; :O  @Y L  @ ]) `@O@ ]@ L@ @G@,@,@A`t @ ) <  O) `6=S<@   M@2O ]@@'h ]  ] [@ @#b@ )! ]] @>!@〦 Hʰ h'ؖ] ]   @^@#@ֺb]@g))@"  @^@ @! ]@!]@`HhM` @ `])  G@\L` G@,,? t  ) : ` O)   \@'\@f\on '##c ]]  @\9@r"] @@ȿ  @\@^ )a ]@h3 @P@Ӹ )! c]]a@o͐b]`"H -'+c]]Z  @P!)@-! ] ] oϖ@&@/^^ @a %'%@c@)"] ! ]?b]]] @`N ^ @ ^ y$@  xd"@ +@;@] I,@`,Z@  [I @ +@ I``O +@[  ?` :`+@(@Z`` [I`@ +@ I` O +@[  ?` +@Z` `vhD 2@$ o,@  @\@@=@  @\@@߰ h v  @\@@@ِ  @\@x@@u@/N "@y .#'Xc] ] \ @x &J N@d Y \#` ]@k 'JN @ @W y\ch]  @^ (J N@J N\p ] @Q )JN  @= n\cx]  @D *JN@3\〒 ] @9 +JN@@$`+@ 1` ؞ Л*%Z @h! @!)c] +Z@]  @ ! ]@Bah    rh. o Ro.pxxxpxxxxxxpxxxxxxxxxxxxxxxxxxxxpxxxpxxxxxxp@/hZ.?) )a ]%a!] `8#c0]]@@!@!@@\.@  OhgO@]@@ (\.t.h[ E`Go]!#P]\0)'#!##cP]]] H@\@  .]@P]@@>: @w\@@ \@!@o]ŀ  Oh&O@B Euh!t@]@\@ '\@ 8#]][@ @ #@@]h E@ o)'@/]J.?`+@>֗0`h*% Z@1'#X] ][  &@hEJ1'#h] ][ o (1'#x] ][ o * '#p] ]Z@ )o  '#] ]Z@o +']] [ @ )a N.]@!h N. '#`] ]Z@o۔ '8`Ё@ /cآ @] ^@Z`c^"^ L -"@L ^ *?^@q@?Hm')#] ]Z@?@$ @^h` o2O^  @5c ?r"r r r  @j@ |@ |@  |z$ G̨gɞJ  `?{@ O |@ېo,@-" @ @t` O  @@t`O  @ @t``O@U] @ t`o$@/jww   wwwwwww߀    @c^_ _  _ @`&`F0s @B @J_@Aw4w!2@,' ?@`$ *oF0-#]\ @\_ @ ?` $ϑ6@׀ @'_ $@%'c] ] \ @\_ϔ@?@: _Ϣ$@@w _ ^_v_w]\ @^y\_ @ ?"`u'']`]` @u`u` @$%'!\ @]]cȔ\ @]Y\\ @?@A: \ $@@t  \*?\  @`!##]\ @<\@ ?"`9'`"@&@\  @ \@|*?\ h@vo\-к#]]Z@? @!#@]o`@O_]?@ 1#@]oo\ %]]o]@Ion^@u`Ob_@]?@ @g]o&oL_'` ]]?^@  c@U]F07 o&''%o@3Ɛ (rr r r r   `@  G__`w \ t @b_\ @voo#oLj''%]]o^#'9co -';o` ' #oc@/@澐@ K h  h  Mh?h  Gh?h  Th ?h  Ph?h  E? ,`( `_]@㾰wg/ʮN`@ I` 2@ K wgK O v@h  G o@x Oo`@O/g @E _gK .@ K`H *̀8c4 ov@i h L@o g @( _g#`8h~ ӟ+p @%Z@ J oېk` hq J2oՐj`dJoѐn#"qJ++oʐj@,5J+po+p!= J40o40@wgKbB `? `?2H+o,``G@ wgI`/Oɠӟ0`!+% Z @ ,Oo G@?wgI? G)?OoOgo{ e10+0!@ ,p#@+ o*= o3poޤ#e0p*0"@,o֥)p#eoӥ4p00004000000000000000000000000004000000@#/#`0p @M`0@;]@/㌀`?`@y HS "@56 !)!]@ @H%H@<]hC @  '   H g&0`"` @[&6 ` @&6(pO@h  oe@J`  1 @: @)a]`G@@ ] h @'@  _s@N瀢 >H @_@@` @h @  "H 0%/kTh]`@n H ]\`Z @ HH&/6 /ဤ`D/․h;`4 h 4 /8]@ @@4 \`^ @n $ 3 O@ 4 \`[` H^*\`hZ ^`ߟ  HRhP hN  3  / 2`o/G6 O.@oP@:] ) 8@U]  H&!# @]@`@)a]  @h! X]@ 32`h ]or$)]@ O!oh@c Oh `8]o"@@ %/⌀` #]^1`1 `8.v@@ /,H! ^@@% c]  @2@v@ΰ h &v @ & @ "@S/x@) H) + @%  l`H!Z)$HZ)Z(耣@ :`oh @ 2H )]@`@  `@ ]  `v/AH=_^ Y H@ۀ H; ۀ`2@*^ ''_@@@ (@ &2 !]1 8 h 80`t H _@ v&@h&`Qo_@Z€ H ߀ OϚ  0_/@'`H'_@ 4` @w@@("] `2@^ ^ 6`^@ Hh >`[0@"?^ ow@20`@ 2H 0 ƀ'`@ ^ 2 [`6 @ @ Oh ^ Y H@ @  ^ ZH€ @ o0 $w/ἀ`?@> ^@ `@0 @,4 @'  X@] @J ^@H Y  ^ {'[ P뀢 @9 뀡`2O^@h3 ^ \Ho h* @ v@% o͠$'` _4 \ @   X@뀢 @' wh  @_o@]o@ $/`] X@ ` ) H"]@ @@` H@8` H @Ҳ` H@' 7'5'9% %#(cH;(wb9&wߊ#$w׺b89& 'wϊ! !ww;& 'c&cxb@w%a3#/ڮЂb]w_]]w_9']!P]__w]]__]]__]]w_]_)']c`#H]] ]r &#)`"p] ]rs@#$bx"] ]rv$&!@cv ]] rr@wru];%3%wwg9& && (1$wwwwwow_;%3%wWbh9( $$ $]wOwGw?w75'w@)__#aww)__g_w"0`X_o___Gwgw_Www"p `_?wow_PwG_7wW!_o_O]`_g ]w7__wO]]__W]]__O]]w?_w_G]]_?]_7@a]] ] (r@()#"c]] ] ] rr@(($& ##@Ȓ`Ȕ0vv!P]] ] ] rrs@wr@t];&1(w/w9&# %3) #w'wwww;'1%w!9&# &3)]wwwww@5(_/؂ &w/)_'_a _w'`____ww "hah__wwww"___]ww_] _]w]_/_]]_'_]]__]]w__]ดx]] ] r'#$'b"X] ]] ] rr##%# %`# Жvv"] ]] ] rrs@wrt]5( (ww;( &9%3()wwwww5& %w";# '9%3&]wwwww7&v$_ϴpc w__"P__wLj#"H___wc"(!_wwww__"_w]c`w_w]]__]w]___w]]__]a8]_]ww__w]] ] ($cP &] #r(#8] ] rv'%]@]] ] wrs@vw@9&5& Ђ7)3('%0a )(] ] `1&7)r"X]]1%&] ]] ]]vr$;']0'b ]] ]r]r@vqp@v@@ @&"  ""@/Ϯ#"`@#H``@ #@h`@]@O#@>]o @}] o@ E^ @` h#` ` Eb`hFA`h- @ h(&bJ oao@o  a8h $Fa` aR 2h @ƒo @o ` gق`oӀ: @/]"`@ `H``Hh\G`H %cH]^ @G^@  "H """"`"@ ,H ``"@ h   `hy$G`2H   ,``H  0 @f`9 "`"@ ,H ``"@ h  `hy$G`2H  ,` H  0@H9` 9`" "@ 0H  "@Zh Z10`h 9`G 2H  0o1 " "@ 0H  "@Zh Z10`h 9`G 2H  0o1 @"/L`"@$^H``@ #h #c ]\ @\@   `?`?@"H ^ (h^ pGꀠ`2H ^"`"@/rH)``H*?1p!@h1p 2` h @r ( H1p r phr (h" h h Hr (  " h  `?`?@2Hr phG܀`"@r"`"@ H``"@Z 8 "`@ H``Hhr 8"@r 8"`"@Z H ``"@ Z Xh  hZ XG`2H Z "`"@Z H ``"@ Z Ph  hZ PG`2H Z "`"@Z H ``"@ Z `h  hZ `G`2H Z "`"@  8H``"@ hh  h`?o "`"@ (H ``"@ Z h  hZ G`2H  (@"/Ӯⴀ`"@ ^ @H``@ `h]^ p"`@  @`H p`@h `2H "`"@ H``"@Z p @"`"@ @H``H h  p`?`? @h v@^hvH po @"`@`H``H ^ p@Ho^ p@v @"`"@  8H``"@ hh  h`?o "`"@B 8H``"@B h "`"@ " 8H``Hh" h"@" h"`"@  H``"@ hh ``?"`"@ H``"@Z p "`@ H``Hhr p"@r p"`"@ 8H ``"@ hh  h h `?G`2H  8o "`"@Z @H ``"@ Z ph  hZ pG`2H Z @"`"@ r @H``Hhr pG`"@r @"`"@ H``"@Z H "`"@ H``"@Z @ "`"@!H``"@Z !"`"@ H``"@Z  "`"@ H``"@Z  "`"@ H``"@Z 0 "`"@ ,H``H h rG`H  , 0 ? " ,)@" 0"`"@`H``H`"HZZ@ hr o*@G`H `"H 0 0@ h" 0 o*@" @  H @ H 01  `9 "`@  H` `"@Z Hh yd"`@  H `@h `2H " "`@ `H`HZ p"`@H`"@r p"`@ `H ,"`@ `H 0"`@`H ,@ " ,"`@`H ,)@ " ,"`@`H 0@ " 0"`@`H 0)@ " 0/@$F^ @ R   zyt @` F `~J`zAb `vEE   {e0@2@`3'?c  `Y#~`J3ZZai `<# @] @`@)#'!c ]  ]Z@ #^ @^ @hn ]@`O#'+`2Hd `!'#]] [ #@@^ hS '3#`] ] Z@#o #'!c ]  ]#o[ '# x] ]Z oޔ#3'c`p]  ]#o[^ P H@wȖ $a@]\ @ \@ @^ @aR` @<_^`8@> h@zo> /@^ @E @`? @@`  ze0@ 2H$E ∂@@   xdyd H`!$!@] \*@\@ @ H^ P @wj@ _Z8@E  @ @ zd H `0 @@"@)@h>  o&`0"H> E −@@  zzd2H`, @2hڱ> `,`0 `? `@@&`,@  @ @ @ ʀ ` @"&`0@ o&`0>@``$F!F @ @`  {e0@ @w!AJa"@@  {yd@ 2Hl '?c @ @ `e3aR@`W ZZai@ `J3'#@] `@)!'3#`]] [@#@ג @^ h ]@O!'+`2Hu  @ `@ ` '`]] Z@# @^ @ h`3#`]] [@ o# '#]  ]\@o#c]] \@ oߔ# '#`] ] \ oՔ# 'c ]  ] \@o˔#^ @ '#`x] ] ^@u#o H^ P@vz  $a@]\ @\@ @@wɐ_Z 8@> 0/쀡 H ?`,`0#?   '@[뀢 H3 `@А H- @ޒ H' $`@H] @  H  @?h #?^`  v`&`,`v`H&`0 @"H&`8 &`8ov` @ /༈c]q@/@&w']\@ "]\@`x@`V@ @ذ h\ "b1]]b""] ] s ]s s@'sǢ @"  @ U_@Z@X_Z [8_ ]h&D@ ]s_߂b]|4] &@ot@ o@S @t@oc@#\c] o"0@w@Z@@ @^@^`"ƀ_^" _^@"ƀ_^*?^_@ /O b ]@  : H@2)aЂ ] zT"Ȱ H@] @/,ဢ @@ @  0`@İ '@! r = d* ** @*  b@]@)a]  4@#h b]@h@o)@ )/a]"@ @ "@]    @ @%`@Œ :@(@h @mh@m]o /h̐  z$4@@F>@aZ~|@&v@#b] b] ]   '@@s "@] @ ,@2@0_*@ X`@_"^@@^@ h){4@* o'@@ v@hz4@- O ?ƀN O@?@ϒ Oo@o0/M  @q W- ]@6 @\`L H@ H `@@hR@Ȑo☔ ]  ] @ b @G]?@0p%@@ )_]@#\ Z   @l @@\ ? @;_瀥`@ ]@h@o`@h @{ @@@ʌ 2H  @9 H   @_ho o: )a9'ː`    a0'w`/\w3-w%!w_ _)_!a (!8a@ ww!wwwwwwowgwWwO  ` '@'_]@_@v@0@@]@`H]@  @x]@  O@@u_] @˖ /_] `@]_!@q! @M:  @ҝ  2@`@ _o@i@o@@]o @@Z @А` '#_W]9` #]@\@G@塚o@@_g@]@<9'#@ __]]] @#x @Ő hS`G_w]@o@@] o@u_]@[ / @_o@v]o_@p]oi@А @ '` `d O@ h _O ] #]@[@G@o`>`@O]o7ǚ  'Ùd`<o*'@/@ e"`\@\` ?` `@\`@``\@ ̀O  @"9).v@!Ь!HPaX!`"` \@\`"@\@"`\@]`@,``4@$\`@`@^@]@^@\`@^@^@@ ]\@ !]@ H+^@ah@]h@^@o]]@`o܀@]@ܒo @/0'N @'p]]Z@#y @#  @^@ ?')a]@ @6#)`@8)+!X;a`5a@]+ *]@# *]@ @ @rL `Oh@]@`O@]oax]@~o @1/Ѯ ]Y@ @J (`] Z@ @+# 2@# #)a] `@ @s]@^ @"7at]@ $H& !@H]h  Д@C] o @ o#) a$ ]@#$ ?  !@5] "O$ o @<o]Z /yⴒ" "b] ]  ]  ws@Ѥ   @̐ @@@@)a] @!]@^`h__@@gX`Z @@S)a!] @ H\ ]@֔`_@z+)/'laЦ]w `wH '@ƀ@]  ⨒b]!] ]   @ks;aаb] ]  s@] @@@a5]@@h@]o_  a]@ O)o" ~t~@@-@D_Ā+ 9) !Иb0"(wϺ] @[#)aЀ ]f@`4@c_^`@]b8`@q`9\@*`\*-_^@]"^`Z  $^``a]`H "8@ ]@_ۀ @@_hY@o!o]@  otz`@@͒ @"?\@@o\@@z_o׀@]o@]o^`_@`^ Z  z'ےa] `4@@]_@|_oO" @] o]o]w!o] ao] @ /b@]@-  Z   b @] @80 @@또)!]@@< hGX@] h@`ƀ@R d`@|^@ `?~t@Oo@ Xo@ ToаbH*] @5'Z  3bP] ][@(@h @ 6  ?o5' (/\``w]Y@l  @W Hh@7 c]\"@w_ +%װ @s]@@+-w @ ^@t\ ?@(@&@؈] @?_=Z X`8@f h5bo%?] Z@ ?_@ ?% )!]@ $O_ b`@]o_ !$ ] @$ ? @] "O$ o @o@#/'l`]`HM0` $] @"h]@+ H7@o @ `Ȃ ]$`]h0@@qH@M?@I @k H!'#p] '] [@ @q1@oݰ`@ِ@ OԂ o$@ج ? o$@%/ή]\@ @$"x @k] @@,@2] %t@@+] t@M\@ht@@?o@m @"]Y@@@:\@] @5\tot@@  ~dN`?@HN@`H` @t@h  @ H @ȁ @ @:   Ӓ @ ^ ?  @   @Y@   @  @0`@ < `)0t@Y@  @j@@א @ @  /+|@Аh{@! G #]  ]~$yd@l !7⠚"] ] ]   s@j9"]   @` ] @@ @_   s@J] @}@ *@~_*"Y ]@_]@X`Ā\ @ _"@h @2 \ ̀ \o@@T @@Ǥ @r @m@ @\@1@/h`?@*h@ /~Ȑ @ @5 oZ [`8"0# " sa]"[`8]  @]!Ж ]   @ @@@)] @`4@ !#`@i:]@ސhA ^`!] 8@] o#_*@ X`@#@i&] @ʐh-@FZ @H` H 1)!]4@ ^`@ѐ@]_o !Z 8@]o)!]@`$H @]  @  ~4~t@@ hy$^@^@  @  ^ ^`~4~t2O^o@/( ) ! c]^a@]^ *?^@/@釐 9@3u@u`h_ 'c] ]   !@\@# ] @@@א  !@\@v )! ]a@꼘@(h/ 1'#] ]   !@\@\# ] @@@  !@i\@F )! ]!@ꌘ @  @^t ^  ?h @ h |^o@^^  @Ӑ ?h@o@^ H @\ @ @@ @绁@oX`Y 8@o\ @@/ h @p1$#H] ] " T" X" \ " `" dr@@@ H @X$ (@@@O @<@@Z @   t H|t$ P@=@not @@@ P  HZ H @\ @ @  @$ P@$@=ot @@Qot @X`Y 8@ot H@/X@  H#]@@@^/ /^  (^  @!@.^ $`H] & T & X & \ & ` & dvv v Hv @^ 0 ^ 8 @b]v 8hv 0@o@o^ @o^  ?/Dr@%7w w״ wϐ] @wǀ H wc ] @ߴ  @\@ !?\Hs€ے9##]]   s@㸰 #ؐc]]]] s?  ss@k @\@ |$HX@@@3!\@ *\Hŀ@P _t_t _t _@$ T_$ X$ \ $ `$ d_*t h$ ZZ Y`8Āo@nH@_\@ot@?^@"?\@Y @]Z *H @F# c^]@]`_Z *   ? @ @M@w?c_] @Z3Z  31#]]@\#Z  @@^o\@@+#ow@ ow@#owǖ  s@Đ[@ @oa@n [@o#9@nH@\@ot@@o  @  H @ Z/l@@  H$@ 0`T H$`T &@`X&``\&```&` `dhB&`wH]    'ߐ''''@6*_*@ @ &@ &` &` &` o &@`&``&`` &` `H &`@$`T`$`X`$`\` $```$`d_ @%#h @f]@o_ǰ @/@ $cH] \ @P/w@wN@ <@\8  @l\  "@q\ \ ? ? & $h'c'] @&\@ V\HKw(`@ \0*ABw '#]@] ?7p%_ @ߨ@"D((@ (@_( @\@ \H \_Z X`8ĀhV@mH@\@ot@@_o\@@ \8@tt _"@5X@ 5@@]t $ $ $ot8ƀ@t @ot  H;_t0; c#]]]  s@~) c#8#0](] ] ]s   s@js?_50%@נ@_@ _ @@ "O}(@|.ot(ƀ'\ ]@! @y\*?\  !_ך#0] @_"Z @"Z "_ T>\ @]Z  @@`\*?\ #8]_ז@_"?4(Z @"?/(Z "?,(_?( +Tc~\ @]"\Z  \*?\ o(@G 2O\@k`%o'@> "o'@5 2O\@Y`%o&@, "o& ?!o bؔ ] s@50%_@נ@oMo' @k_8o(@kH@\@ot@@J@G"@\ \ "~\@ 2O\\ ƀ "~\@ 2Oz\o{*~v\ow*>r\o@ >">b\8J   o\f@ /w   www #c(ƀ^ ]@6 2@^ ^ ? ̀| ̀z @x_ u_ rhp_@]"?^Z "?^cH`@ "@YĀ\@*`o^@㆒ @G*\@@ @9*\@]@U  @)_*\@@㍒`_*?\@_׀@gِ@3ow@_瀢 h_wowπ 2o\@_ϒ@ ow_ߒ@owߒ@o@ o@o@/TX@N\`@}Z *hD@t^`Z *\ h; `@A H4  #]@_^ Z   "^  ~$|^2O]hf\`@ O@o\ @` O@oް/@ (`H cP]@"^  Z    @ (`H@cP`@o] h@^? /ϮDcX^ ]@   Z `zTc`^ @]hX` @B]@@/@ $cH]  \ "H \  @/ @ \ @5h@4"?\ @5\ @t  o$ /yw@ ; ǐ @ @3 _@@ X`#_Lj` @h@c4]@ _ǰ@ ?@/M<cp@ ]@ϰ@/:@F c]\@ @@i@Ӗ € \@ @ @h t@@o@o\@x] /@ᜰ@ / c@ݡ] :@@ `(@@  @@ /   @7 hz@ᆰ0/ٮl@wߺZ @  \Hw#]  ] - @8   #И ]@.]?0p%@`_@e@c_\@ \H __f@hbZ \8Āo_@ieH@B\@ot@?= \ @] Z {t\*?\  Oر=   3@2  w@_?Ϊ\ @]"\Z "\  @ \@@l @ `&O\@@= .0u@ \ ?= o\@ 2O\@@o\@ @i_  ox@iH@\@ont@ 0 ?/2А F"@N <@7p$@]@ @?@h4 + <@ @?1 ?@@?c@ :] @ ?o@ p] @ @o c] $@@@ېoɀ  ?/ Lr@@ؒ :"`h)@C? "@)?Ȥ`@ @@Wh.[  *9Y?*,@Y?K2@ # ]@0 :,@#oې?#]@#o :@N <i #`?/`?@H @t] z4: @ /vcp]@ @/k@M`@: `@2 $?@sj6p H/  @sc6p H( @rJ H# 6p @sX H @\\ H T@rϐ H@ "@$ Ph  $ (t 0t 8t @ot HcH]oβ?@^  \  \  @@ȁ@o@o\ @߾o\ @/$@ c\@! @߱] @@\ H \ "@ X` h  @f Hh @o0/\@l ^ 10 @ `%)!]@`@ @u]  Hs  @চ &^ Z [ (@ ^ Z ^ (h ^ ```` )a]@G @M]oٖ Ho"+ o"+/<w] )a ] ߸ר `(?`0@h`  @]ssssǒ ]5  @؈@%_;`k#j ,0 "`@ @ "q*pk`@*`@(@@% @@ߕ o@]o_f%#]@Ð_@ @Ɛ@_h@o##/Iw@6>_) ww_ww"+ __w"qaЂ 8* ww_`@`"@\ 뤀 H@E @S  @ߥ "J ^ r ^r vv_t@r@]\  E[`(]@\ [(  H_Z Y @ @% @]  _;`i @Yi#j` + "@GO`hM\ ^G@t o@ oܐ@l o@ ;`icj .0 " `@ @ _@_@] o_]`@ __@]@@ oz`^@*]o@oy^(  oj@#/∈  @Z]@/|\@`@l#)`"q>`*Ϫк`H HV\`\`\@@E @ \@Z  E[(@ h;`i @bi#j )0 "`G݀"OhV ;`k#j )0 " `@ @ @ @s]o@s]]@ @@ o@]o\@Z [@G@ o\`\@@o+ H^ >`^ @^ @#h  @sk]h  ^ ϔ @^oc/@V" ^  @~ h<@ '^`*+ '#P]]Z@?@  @~ h' Ho ^ ^ @`@ h@  #`]@sh ^Z X`G@D o0/Ԁ`@1w瀦`H'``@ _"@ 1'@_h&#x]  ] [@i? @1 h  X``]]@:o_2O_Xo`p  Xo`h'/[w@!$"q_(p #"0`] w!w'πHW HK] ] ^`^`^` ^`(^@^`^`0^`8^`@^`H^`Pwwwwwwwwwww>@]"#] @ s;`i`@mi#l )0@@$ Gǀ"O'ha@_@rv] oZ ZG@ oܰ] >@]oΦ "H/] ] ] ^@^`^`^`^` ^`(^`@^`H^`P^`0^`8wOwWw_wgwww?wGwowwwww']@]]`Z _ssZ@] ?  ?o]] ww'w7'/]]@Z ]`ss^ ] @ oz㾠/@-$!% #"q ](pϬ#`'πHA뤀`H5\`\`s^@^`>@\@""\@ @ a;`i`@[i#j )0 "`G܀"O'hO@L @q]oZ [`G@ oݰ\`^@^`@T\@oϠ뤀`"H\`\`\`^@^`wwww'\\@\Z  ssZ]  ?o\@\`^@^`wgwowww_\@\Z \ssZ@] _ @ oz㾠/@ #"q`)0^ @ @ hv`"HC\`\`s^@@\@. 2@^@@Ր @:][;`i@Ui#j )0@" Gـ"OhI \  v@ &\ ow@Uo\ \@Z X`€_G_@f oְ\`\`^^^''wwws^@@\@? @^@ \  v@ &\ ow@$o\ @| @]o/  #"q)p^ @  @# hD\`\`s^@@\@0 @$^@ \  v@ &\ w*;`i@$i#j )0@" Gڀ"O\`h@o\ @0 @@]o\@Z X`€G@ oذ  'vwײ_  @〡`H _@ X@@ڨvh@ڤo/@Ϥ#`' ) "q*c aк H Ha@R`@ [; kcj )0@ "@?@Nk@`"OhH ;`i#n *@ &@ @ @ @pA]o@p<]@ڤ "@]]@@W o@B]o] #@\ @c h\`[ G@D o@o/@Ϥ #)  aВ"q]*p`Hw`HRs >>? @V? @ I;`i@Ci#k *@ # Gဣ"Oh7 ;`icn )0@ &@ @ @5 _@o]o@o]@`@@ސ o@]o\`Z€G@֐ o @o㾐 #/$ @ )`H!Ј"qwW])0wOwG`"HU^6@C2@8Z  ;`ick )0#@@@ِ @^]n;`i@hi#k )0#Gπ"Oh\@G]`4@]@q o@\o wZ w Z hFw \`[_G_@b oΰ^^ww'w'@S? @  Z wZ w Z ow  ;`k#j` )0 "@ @ @ @x _G@]o_W@]`O_Oo]  @ːϐ  ^ Y G@ ;`kj (p " `G怣O rr`H`Z r@ H h ""Z`hrO or@^  ^@ "@ #0^#0*?^ @Ē#8@ِ v\v#0t 2*p& @h p`@ة cO *? o@ ^#0@ؙ\@ؗ ? /@ 'c) "q])0и` `;  xw_^@   dBi@ @Lic*^@ #\@]\ @^@^c0@@؀^@ "O^c0_ _Z*@ X`8Z X` @ ϐhU[(@o_: o_^c0@@`^@`߀ @  `_'wo^c0_$ ?נ#{ \@]@N\ o_ח*p" * ,p!@`O] $O_]@^@o_``'w_ϒՔ o\] @_#@(\ h@oi@ /c ]Y "  @` Y   @/O"! N @ h `@] "H `]\ *@\ h  @ "@ \ *\   ?`0p @j@@iž@@@m H `@``H@T @i@@i@ @j&@@i@@ H  ` H @k@/@?(`c`H  ]@g` H؁ @ $/㐈c]@g X@ &/خha?`]0p @Sٙ @/ˮ4@m H%``@`@ `H  @S]@gv` Hց @@m H `@``H@S@Ӂ @@ݐ` H@` H@i+``HH` H @`( H@ @ $/oĴb?`]0p @Sp 0@@l H `@``H@SB @@` H @h` H @ H` @` H @β`h H@h @/ڐ#```H  ]@f` H@hǁ @Đ` H @'` H@h @/ؒ#```H  ]@f` H@ @/ۮt%`` `H@f]`#  `H ]@f_` H@h` @@@@` H` H@ha``H @j3` H@hU @/X@א` H @h, #` H ]@f @Þ@@@hm H`@hh @X H  @ H   @`@hV@/d@(`c `H@f ]` H @h4` Hρ @ #/ܮ`]@e X@ #/Ү༴a?`]0p @R. @/Ů@ks H%``@`@ `H  @Q]@e˲` Hց @@kV H `@``H@Q@j @@2` H @gֲ` H @ H` @` H @g` H @{ H`@jˁ @/WВm%`` `H@ee]`' 0 `H ]@e6` H@g7 @֞@@@ѐ H`h @/%@´ 0` ' H ]@e @/( X` $ H ]@e" @/p@hא` H6@h` H/@h``H(@g3` H!@`(H@s)`8b  H@d]`@`H @fŲ`H H@i @/h@h` H6@h` H/@hs``H(@f` H!@?`(H@1)`8b  H@d]`@`H @f`H H@' @ %/w\ch?`]0p @P֙ @@hH` H @hA` H@h< `@2'`@"ϒ@f H+  @h% @-: Ë)0 www&`&@&`&`o&` @``` `''''@-'o'@R`@2'`@"ϒ@fc H+  @h% @-K: Ë)0 www&`&@&`&`o&` @``` `''''@-'o'@Q@ &/a?`]0p @P@ @g@@ %/Ϯ༴ch?`]0p @P. 0'@f H `a H `@f @ H ` @fڔ @ H{ `(@fӔ @ Ht `0@f̔ @ Hm `8@fŔ @ Hf `@@f @ H_ `H@gi HY `P@gc HS `X@g] HM ``@eȐ HG `d@e HA `h@g7 H; `p@g1 H5 `@e H/ @e뀢 H) `x@g H# `@g H `@e H `@e H `@e H  `@e H `M0^@w@g``?@ @H: _v@@` H& ` H @eV` `H @eN`$H @eF`(H @f@ @/@f` H@e,` #? 0`` H10 ]@O9 @/̮ఐ@e HU `0@f HO ` HI ` HC `h@eݔ @ H< `p@e֔ @ H5 `,@dݐ H/ `d@d H) `x@fu H# `@fo H @ H $``]@b X H  %?!X``]0p @Nۘ : @@f7` H @f0` H@f? 0 &w/X`@7 ^@  @)  ] @bf 뀢@<  H^@^@^ |t'[P@ @. 뀡 2O^@h( ^ Z`H@o @v@ oԈ&'` _  Z]@b2뀡 @' wh @_o@/ᄐ@M H )`b @ @N<]@b  @/ @Mא H) b `@ @N"]@a  H@e 0 )w/Ǯ`@7 ^@  @)  ] @aՐ 뀢@<  H^@^@^ |t'[P@ @. 뀡 2O^@h( ^ Z`H@o @gv@ oԈ)'` _  Z]@a뀡 @' wh @D_o@/p@@M^ H #`b @ @M]@a| @/Wܒ@MF H# b `@ @M]@ab  H@e1 @/9d@db @ H2`@d\ @ H,`@cy H'`@ct H"`@dL @ H` @ci H`( H $`@`]@a* X H `H H@d`\ 0瀠`@`H^`0@)`@6ww@d H h @d Hh @d H ^`0@)_&`^`0@)_o&` /ਊ!]`@? %aP]@`@5)] 4@ hE  @]h@ @^` H;  6 ^@@, "  Z "@  Z" J2H# # @?] H ^@@,h @W!`Ȗ /]@(@X O %aP] o"@ /,% ]^ "`^ @ (^ 0Z8€^  @ ^ @  @ސ@X`[`ov@ov @/ox `H  @   `  ( ?]$ ]@P4[  @  \]$ (t t t x$ pt t 8 p^ /D\  \  v ǣ|4# ` )a?!Ь`ز@b @ @wwwwwwwߐ@@X @`"@p\ HX``2@Q] \  H\*@@X`__@k] @_Z @]!#  @?1]  ] @@*z  ~$Ohs  _ s@!#\`_[@#`os`@| ?_[  Z@!#oۚ Y`ot@bot @?hL@`2G]?ϖ  G˓0`\ *p $o$ _vt ow\` X``ǖK $ ˓2 voo] ]!v @0`\ +p "$ \  \@X`[@h t@ot @ o9t @^ X`0Y@`( @^ X`0`(Z@ @^ X`0Y` `(@^ X`0Y`(`(@^ /GX`0`(Y`0 %" ]@ @` $!] H#P ]  @ h * ]@ʮ!@?%!] o"@^ ^ 0Z`8@ (^ Z X`8@^  ^ @  @^@ΜX`Z€ov@Δov @^ 6``(X`0Y`@@ @@^ X`0Y`H`( @^ X`0Y`X`( @^ X`0Y`h`(@@G@{`?0/㐒("0 ] ] @| b8 ]@| @5?@x0p%@{>@{<  _"_\ "@\X`  \*?\ _ @h @u 2O\_o  /−"("H"@] ] ]   @{s bP ] @{ @@z@z_h, "@* X`@zeZ  @@_h @ѐ@ ^ _@{> h@ o @ "O o  /a,"(H@]] ]  s@{o' `"X]]   @{cs?@敗0p%@z@z X_]@z Z Z  @H`_\@ ?w  H '#"h]]  '@\  @@ __1@h-+`Z @y]"?_Z "?_ bp @[] O_'a]  Z] @? @q oװ@͕ O_o΀ /خ"@(H] ]v]  @zs bX]  @zޒ ?@0p%@z@z 6_]@yY Z  " _[w    H_ ' #bh]]  '@P\@ @ _@h @ O_\`@ͯov /vဒb("H"0] ]  ]  @zs b` @xI] @峘@y@y!'3#a]][ +@ @h$_ \ @X`  ! ]@̗  H  p  @̍] f` h6 @(6 @ / @!( '3#a8a0  H$ ]]Y@Ɓ]]Y@ o+] /!"(! 0] a@]  ] w] s@z  wbH]@x   @y_ @/߰@y4@y2__@ @ϱ>`h@>`o >`  /⠤!@a !]]b("H"0] ] s]s  wss@y²   @y @@x@x_@ @䐱>`h@>`o >` /ᤒ"("H"0] ] ]   w@ys aH]   @y @䶘 @x@x_> @Uh>  Z @x!"?_Z "?_ @ˑo_ /8b("P!P] ] ]   @yHs^ Y ( @ @x~ @_@  /b("H"@] ] ]   s@y aX ]  @y @H@xM@xK _@<ha _@ ]@wX` 2O o_<0/ήb(b@] w@w] "H] @wY  a` ]@x֐_ @ ߰@x_@x  _߰ > @h? Z @wvwZ   # a  ]@  "O_߰ o_0/ἔb(b@] w@v] "H] @w  ah ]@x_ @߰@w_@wÐ _߰ > @_h? Z @w-wZ   # a  ]@ʩ  "O_߰ o_@/=b0b(]]@v@6  ' #ap #ƀ2 @wH] @@X`@@  "@J'!]]Z@#ْ @@@;5'#ax]][@ o#]]@[@u @) /0!(H] ]]  @ws bX]  @w ?@0p%@w @w X_]@vZ Z  H _[ ?w  H ' #a]] #@]\@ @$ @ __1@h-+5Z `@vc]"?_Z "?_ bp] @  2O_'a]  ]'@/[ @ oװ@ O_o΀ /^ !(H] ]v]  @wms bX]  @wd ?@▗0p%@v@v 6_]@v Y Z  " _[w    H_ ' #a]] #@\@ @ _@h @ɋ O_\`@5ov@@K@ z4@/p /@ɭ \   a @C] 2H h,@ɜ ? /Ԯb("H"0] ]  ]  ws@v aH ] @vڐ @ @v@v __@@uX`Z  a @] H@'^`z4_@ᚱ= @ /a^ ]@ub  Z   ^ bP@uW]  Z      |4|t@@"<`@@ "@ \\@  |4|tO`h<  @ @ <o\ƀ  v</Mܨ'7'ƀ9N @ʪ0("H]]]s  @vT;+a"H!-] a] ]] ] s   sss@v=sϢ?10%@o@ut@ur_@hܰ _@ٰ X`@tޒ Z  _! !  @[] @S_1aȪaЬ"H\ @t]"D Z *A \ @t]"< Z *@9 \ @t]"4 Z  ]@5  2@+ \ @t]ƀN`2@Z \*?\ @_瀦 @hG@_hGې@h  "O\ "O\\`_ߒ` "O\ o' (P!P]]  ] s@u#a  ]@u    @ߨ@t@t_"P op_ _hI 0a(]]] s o7(0] "H]  ]  @us a ] @uy @ଐ @t@t ̀_@X`@t Z ?`J  @@=_*No0@d o@/-\@ . a]@ǁ  H @ /a ]@pa`H ]@f H 0 /㘔!"]  ]w@Bj*p!@ )0 +p"`x` `?`?@ @`@"_]@s[ Z  @_h  @ov@_@/:  ^ (a@7] 2H3 ^ "@0 H@ "H, ƀ)&@^ @`@Hs @@[ . a@] 2H . &h < o a@] h<   /~@ "( "Hb] ] ]   @ts @rN @߸ @s@s _ @W   /Mܠ"b #]]b(bH"] ] s]s  wss@tQ  @tL  @@s@s_@! :`/@WZ)@\`"@)^ ''' '@'\`\` &@ 7)i АJ ]\`(@@ @$`03`*0@ <1`@8ht%@$`0`0`4*`%) ) ! ]] c 4@K *o `2@ `0H `\`  6`@`#2`@__ww'@#hf _ϙ+_נ@ ww'@v "@$ &hT ϖ@/\"?  $ ]`GZ @] o @ 2`   @h]o    @a]o o! @@Z)@W`0#x4 ]+0@`@@ּ`<op`0__ww'o)!]@`Gp@֨] o&/*@  #]`@Z)@w##@  @ƒ(8g\@.!)!]@ @ @xh\Z c@v]o__@5)]@`@Z #_@c] # @4] o\@$` 'Y _ϰ`t`)# Y  t`]  K@] 2)'t` #@4ܦ!X\`]` \@ :h t))!]@` tt h8 #@)] o\`@Q @a"@Śh+\bP]`O )!]@ $H\@ ] h\ @LU!c /]@ܐ@  Og#bP] oc"\\ Z \`(Ā= w϶w wo/k__ _o'''''@I3+^鸒 'b 0 4*@Ą^ ! ))aa )b & 0]] aЪ"^Z X`4 @0 ] `(]  @ @ե]^ @Y@@ !$@@&]o^1' #]]+@{]!@ h0@o`$` ƀe )-!+3www)!'bbȚwwa#ww"` "@$`^ ``@ *H`_]`@1`2@R]$` ^ `` e@ 2`* H ` @@ O`*ƀ#$`]Y@ `_]$@^@-]^ @4["] @!)]! ]@Ƭa  $`^Z X`€ 0^  & 0``^ ,@^ 3 ` &(pl%)" 8 0] 7`.p! 4 03`-0@%< 0 6+0@$@@ 4@C 0 0^  & 0`@ 0^ ?` 4`&)pn?" 84  0)2aл*]@' 4 03`-0@%< 00`.!`@^  $_$v (@h\^ (@?_b@@Ԫ]hQ^ (bГ5 ]*p`@`8@ԝ`<o 0_w ]\@+@z-) ]o@4oq%$`^ ^  J@ 1`oH ^Z ] _]`@__@t]__` @```'''''Đ O_@ _@\]  & @@:Z)@  X` @ h X` @ h @/Ǯ4@"Z) +&@aZ(X]Z @hP@eP\ (\ \ % l "gK @ $2`"*h\hX 0}H$-)\hX\ @ @vi H -)]@@"@]  $i \hX\i\ ^(^^ @ @jJ@$ ]@F!@6 H ?5 4 !@`7']@2eP 7 Ȣ$@]@ ]@ @4`g!"g   @&@h+w@@J" /] @Œ@2 H ?o$oӘ @1"4`] @Ӝo6  @-) 2O\hXoi  /h@oZ)@\`  *h  6`\` (`\X  h$ Pw]` _\`(\`\`# ` 2 lK@w߀@h%@ )a]@&\X? [0@_`0)з2 ] .``<`8@'ۀHG3)a]@@52*&<\@&@@t)]@ @@\X= [0_   $ @@ c0@] h @@ #(]@ o\X#3`] ۗ6@4 o`0'@3`)+0aд@]&@@ 4@`0`0?`)p$`0ۘ@! 8`02`,@" 4`0?2.@!`<`06*po `@?2 6*p]@@o`0@S@Pc7`6]@ҹ_ou`01)!]`G:;7 c@Ҭ]o5 7 @ҥ] oM\X`)] &G& @'@$1# ]@ҏo @o])o)@/ D^)")^ ^(XZ (P @^^` ^(3!@i $N @ l@ $ #@ H0 }H,')')]@4@5^(X^@*@) `2H ^(X@ @cH@I] &) ^(X^)Z` @^^(^ @  n# K@i@ # ^(X<Z 0€|4^(!@ `Hv(0Ж] 2+@<$@"@@`4@\00`*p&0 `80^ 6`@+0"`<0(Б4 *0] @ `40 3`+0$@ 4@+00`)p&0 `8?04,p@"40?4.0" <02(p@$@`HO0?h6 6.p] <@ρ#`2]*p6 4 <@ @o0?#X2]*p6@`@@Ѷ`<o0]@4P@Ѫ] h&)  @ 2O]^(XoN) 2`@0@њ] oC^(X!]@`G8@я] o @^)\ @@}hv)X`Y @o0 /c]@ @&'%x] Hg2 @* # . 0` wߙ,   2`ߊk I@ #6 @w_hJl x!@@,] x@G] &x] @cH1)##@ !С|t]  @ f@H  @ @"@ ] "@] )!@"] t!О ] |t`fOx`G )!] ] @\@ox0@-w"@ "H^_^  @=Y  "@\\\ ?^ @Y t^ ?h_\*^o^ _@^ "@ ^ (X@ X`Z @^ ( @u @>@@oY 8Z`(@o^ @/ P@n   !0" ]q@@" " @@ 2H" DB D@@  `@ @ݑ@^ & @wv @@B H" H@@Ȱ?@ @ \ `   fw@@Z @Z (  z4~4@ @Y@*Z 8Y`Z €t א\ ( @!ht (@5ot (Z`(@o\  @o\ @}\ ( H@ \ (o@@y Z /a@k@ @=\ ` @ h6@:`\ $ @ @L# @;h] h"@GZ ( @ @ڐo o\ Z X`@G@ h@/X@! @; @a\@ `X    '''''@6Q\`) `@`@ #`@>] ?@Z ( @y8 6@h/0 h+Z #X`op`\`Z X`G@ @`@Z ( @U @fo  o@6u\`o 0  ~$~d/㈨@@  ? @`v+:`v@' @1ua  6@ Qv@ 5?!']#]@u[@  @婐^ @@H@ H]@@ @= Ā  @ @0 ` @yoʒh@@$o!'#]  ] [@uP?  @r @ o@)]@@  @_  ?<@Y@]oа '#]]Z@?@u$  @ `/ (@ @0 @C\ `9 @@2\% @ # @:] h,@~Z (@w6 4@D@ @\`o* oD@\Z X`@G@ h @5\o /w@~w@߲ ) @!^@>`` __@2^`@h__@5^`o] `@  @_!@>]  0 '/w_ð # ^`]@] @"$\``@]@9ch)@~BZ (@ @ՐF @^ ow oFZ X`G@~ߐ h@5 \`o%#/ (_@~@/ @R  @ ĀL \ `9<``` @`'''ss''\ ? ssǐ@4h-Ā##`@<]@@}Z ( @b! @sh h<ss? \ ssǒ@5o  w/wwww_ŀg 5 )'! u@#u' ?Gú]a@?  s6`_ss_____r 1u ?]@s^^ @H@H]@ @~@ @  `@ @@3 ` @wo_h%@'o@7)]`@ <?_@@]o '#`]]Z@?@sB  @~  @}6@Q @H \@ `<> ? ~d`s\`ss@0@h/  @ ~@@~? <@@ڿ<s\`> ? ss@4Hgڐ@oאw@_ljz^ /خ\ϔ @4Ր  @ҐQ ' #> #]a  \  Y h @ ?]@r\@ˑ\*?\ Ā9# @;"] @Wh1sss Y h >`@3 @_ @wo\Z"?rY  or?Ԭ_ @ow@:]@+_ow  w/rww_@| 7  u@> w@@Gc'% u!?  !s___# Hw@m 1? ']c]@rO[@^ @H@ H]@ @}  @ Ð @ @@ ` @uosh8@o'c]  Z] @r? @| oG )!]`G <Y] @ˤoذ '#`]]Z@?@q  @| 0s  w@{w@  @ ^> ` __ϐ@/w^@ Ðh__@3@^o0 '/㸖_ww # ^]@:v@G 0/Hwƀ}  ? u@vc)' u@! : !7 _¢ Mv 3?!']#]@qw[@@3^ @@H@ H]@@ @|/ Ā  @ @" ` @uo˒h=@o'c]  Z] @qB?@ @| o@)a]$G߰ @ ?<@Y@]oӰ '#`]]Z@?@q  @{ /@{  @ $ @M\@ `D    '''''@.\` @ `@}Ґ #`@9] h+Z #X`op`\`Z X`G@{ @}`@zZ ( @R @ch   h@2_\`oʠ/@z @ ʢ @M\@ `D    '''''@.\` @ `@}x #`@9] h+Z #X`op`\`Z X`G@{4 @}a`@zvZ ( @ @ h  h@2}\`oʠ 0  ~$~d/F@@ %  :` s"q@'v@ +/pu]` 6@G Pv@C 4?]@p(_@  @JF^ ic.0i@"@)0+!@ @>  @zܐ @  @ @@ ` @so̒h@@o!'#]  ] [@o?  @ @z o@#)a]`@   @+ [<@o]oа '#]]Z@?@oÒ  @z    ~$~d/㔢@@ 5# wwv@;'_߬c_ )"q`]w,w :`  6@Ð B +?]@o_@Fl#l+0"@ *  )0 $;s@zF^ Ā  @W@9 `Q @soӒ@/o!'#]  ] [@o[? @z" h8Z @ )] @<_]@\ v@ t #_ߒ@82]@֐h] ?@o3_@ @y o '# ]]Z@? @o!  @yP/@y @ - @A\ `7 @@-U\# @ # @4] h*@xZ (@t3 1@@yߐo) o\Z X`@G@y h @1\o ~; /؈+ $@@x'  u?7)t X@; @s@)t ?%#7 q \ В@r@1 _? ( "qs',Z@@   c 0q@@  @\@ `@6`>\`@3 `"@b7 @y_Di@`@O@3y]2Oߦ @< @  "@]@r @xMZ ( @ @oŦ o ?[]@n8 ] ʀJ H @Z] @ В@ o @@@ oÀhVic+0#@ )0 +!@ OhJ@^@3]@ # @]] @  @ ] @J@ H  @^] <?[@ǂ]h! \`Z [` Gϐ ` @xf`@xot 6`?@h  @x| o@/㬀 @6 "*% Z@@1@H@0@N@S@j'`8]  ][?@m >@x[  p|` `"`@^ P^`P `eP d ` ?&`d&`v`P&``@/ v`h Z h Z P ` dr`h"`r`P"``"`d @ @ v`h@^ 0" ^`0^`0 @^ 0h v`0@o @hv`0@v`0 &` @^ @" ^`@^`@ @^ @h v`@@o @hv`@@v`@ / $`@']www@dʐ0#@  `6`/Ȓ   B5 9_:_~4 0 |@@'  @@@o  ~$|@H%@ )!] `@"  @H6@h] h@o٤@3]@Z_oϊ _oư @v@ʠ H9 @o @4 \ `*>`\ @,h(\ Z X`@G@wK @yx @,@vZ ( @ ̐ ʐ@h Đ h\ @0 o/a@vk @ @y\@ `o    '''''>`@+'\`8 `@ `@y2 # @5]hV\ ?#Y ot \`Z Y`€oGo@v @y`@v-Z ( @n l@h3f h/\`Z [`@ ')!]`O`@ū] ocP] ] +^@@k1@ X]@k\`o)>`@.\`o@/ڮdu # ^`]@4v`@w/Ů@uϦ @ 2Hh@ے ; \@ `1    '''''@*-\`# ] @2@E"\`@@0h@voZ X`@G@vJ h@-\`o#/v@u @ @O\@ `@ϙ? s@*\`  @ `@xO #@4] h4\ ?#Y ot \`Z X`G@v @x5`@uJZ ( @ @ݐh h ϕ6s6? @-\`o/d@u$ @> @K\@ `?>@*b\`  @ `@w # @4Y] h1Z "?#Y "#or \`Z X`G@u @wڒ`@tZ ( @q0 .@h( h 6`6@-\`oĠ/®@t̠ @ @G\@ `=>`@)\`  @ `@w # @4] h/Z "?#Y "#or \`Z X`G@uW @w`@tZ ( @ڐ ؐ@,h Ґ h@-[\`oƠ/n@tx @ @Owww\@ `A>`www@)\`  @ `@wC # @3] h0Z "?#Y "#or \`Z X`oGo@t @w)`@t>Z ( @ }@ѐh w h @-s\`oŠ/D@t @6 @G\@ `=>`@)\`  @ `@v # @3S] h/Z "?#Y "#or \`Z X`G@t @vԒ`@sZ ( @k* (@|h " h@,\`oƠ@/@sȨ @ @<  \0  Z ^ 0@`+`Z*?Z   @S "#r \0r@@ H t0 t# @2] @9h @1] @1h  " \ t or @ oŦ @/t@s~ @ @=  \8 \  @V @*\*?\ }  @ "#r \8r@ H t8@ u@#@2J] @h @02]@h  "@ \`t`ot @ oĪ /)@s3 @M @;w\ `1ϐ@'%\ @#`\Ā v@^`Y`p"@]J@ @]@1w@*?(Ā`(]@2 h_@o]^`oY h@*\ oҒ/@r@w @y \@ `q\`@(ϠN  @A`@u # @2$] w@:_ \ ?`` @k3 _ @ 4`* @vhL# @1] @Q_hD\ @$Y`04`)0v \ ?`o__ @#h4 @1] @:_h- Z "?#Y "#or \`Z X`G@sB @uo`@rZ ( @Ő Ð@ow ow@+o/\l@rf @ @,\ `"> @'\ `@ :`# @-k]h @s^`o\ Z X`@G@r h > @+\ oL0/"v@H  p h]  ]@^  s     Y``dY@ # @6 )p@U v@@rY`6 `dc@*p[`0 tY@*Y`@ # @0Y] @)> (]@͔ 6 @]/ҮD@qܢ @ @+\ `!>`> @(F\  @ # @,] h@ro\ Z X`@G@rp h > @+\ o@/d@q #e Z 0`" @ @#\ 8t 0 @@0]@0\ 8h t 8@/]@*\ 0o#t 8/u@q Ϥ x ] @@[]ǐ`sLjsss]?^ (0p \`0@p @]"`H#)a]`@3'^ @]h-s_ǔ  @# !# @Ž])]@ @ _ǚ[ [[ ] @^ _@  @Ű]@_h_Z`ot@/`@*e\  "@ Z @q # @/] hvor \ Z X`Goݐ  /w@ow@  ) @(!)^@>aЀ``']c ਀ @?]] @e^@u>__h__@*>^`@h] `@  @_!@X]  0 '/xw_ # ^`]@.v`@:@ /`^ @Z]  Z  d@ d`: @ /rĈ`^ @Z]  Z  d@ d`: @ /]p`^ @Z]  Z  d@ f`: $# /FcH `w]_ Gwwss_&IZ   H$r @0\@@Y  "@)Y`Y`Z 0v$ $ $ $  $]@-@" \@Y@  q 2Os*v hZ`0vY` $ $ $ $  o$@ " o _@]_ߒ@-P] /ծP^  Ϧ  H v` @Ī ^ (0p ^@ v ^  %#'Z ] cPZZss] Z@   @ a ^ Z [@π @Q @( ^ Z \@^ "  Z*@?X`8Z X`  Hv π "@-^ `@ v@hB oG@oC @qp  2H H^ "  HZ*@X`8Z \ @v  H`@hg= @=`hc= \ (o^ "g  ovZ`(@o^ @h  G o^ ^  Z \ ( s^ ( o H@ݨ @ov (@B@n @q& @ G  "H ^`oː  O o ?Z)] @ @\`@]  @qo@@ o<2  /@1 @ @  @p`#@,] hA^`?#Y v` D O\\@\ p\ p ` @}t p#\` ?oے^ Z X`G@n @p @mZ ( @L   @]h ZZ@Y 0Z 0@`?@ f1`@>^@@/@@>T H1 @`@1`"X*% Z@`@> H  @*G` ?`1p @? H `@> H @'`h  @>``@> H @>`dԝ  0 0`@ l` @\`> @ @ *Z  t  Zr`Zr`Zr`Z r` Z( Or`(2^@@^`(^`*pt ^`^`^`  s(ssss ;$`t`H; `? @0______> @@,p@\ZЀ`?ZZZZ Z(t ZZZZZrrrr r(rrrrrOrwwwwwwh @oƀ    0`@{ P ` @\`:)0Zt [r`[r`[ Or`3 ^@^`)0t  ^`^` rrr *$``?@#t`____:,p\ [ `[`[[[[`[`sssst  s`s`Os`wwwwh @%o`@  /Ⱂ@(^ < )p@@`  O< hH#@*5]  @& < )p @[ t@ [ ([ 0[ 8s s s   O< @ `/Ǯ䀤@@#`^`  T`  @ ]@)@А`@*O^`@)$ /\ x^ 4`]@]I   *@4@*0@)0@ @*O4o x]  @ @ /zప @k^ $5 x]  @]6 <*p *@sU@ He  4 @?^<   ~8d@:: (p@*d@@$`"`"` " `O":@+0 .0$`$`$` $ `@$+0 )0:@&`@ &` &` &`   O&`$"@`@1`u`  h%`@֐ @$`$ `$ ` $ `o$ 0ߒ@@  H^` __v`hv@@o_:  `@@ /ڮ0HD^ $4 x] @\: ,p@)0@* @:@+& ,p )0< @`$``` `$"`"`"` O"` h& @   @\i: ,p*@ O֦@  @h < \@ * @@  @O<  @ ? @<`^ *0ې @ @6@^@<`)0`-@x @ @O<`^@*^` @@<`(p`@ .p@O<`@>h# o@% $  $  $  $ o٨ @@O¢ O@ o @ 'c/}̮a@ +тƀ bW@@@J]]@_=[@ϓ@@/}ገ@&vH 1 @ϒ  @ $ @  @m @ @:44 6)0(p@, -0@@]`   $@ #` #` #`  o#`44 +p+0  + ,@@^` @ @ $@#`#` #` o#`v&hT 6-0.0@^`++0]`@@κ4 *@$@ 4 @(p^`@+$@ @  %   %  %  % @ G@ Oթ4o4 o@o]`(p@@$@@`"  `" ` " `o" @`x]`] @z@^`@u oo  ?  ?1p( !@6  @@ @k0`@ /|h @Ð^ v`0@u ?20 10 2p  @: &`&`&` &`&`@g ^`(: @)0 %@!hv`v` v`(] &`P &`T &`X &`\ &``N`@;`P@ @v`h@ v`p^ @  ? ? @, 0p "&`, ?߈ &`, &`d^ v`x^ v`^ ^ &`^`h@#^`p  `@%]h @   v` r" &` " hr Ԑ O&`P &`T &`X &`\ o&`` $/||l#Hww' ?@%6 @s h߂ah]    '''''__ρ(p $/{X܂#Hww' ?@%6 @O h߂ah]    '''''__ρ(p @͆ @6`6 ϔ@i __ρ(p @r @@6`6 ϔ@R __ρ(p @@[@@V `@``` '/{d'''' aX]@ؖ  '/{sswwP] ^ Y  @  z$  & /{ۮw''''ww w w w ''ssww'# `Z  Y]]@ # ]@x /{(     ' ''''Ϟ#P'wssww] Z ]Y @ z$/{H'    H ' ''''Ϟ#P'wssww] Z ]Y @ z$      '/z]''''swww w ''wsw# `c(Z  Y]]@ # ]@6       #/z-''''swvvvvv 'wsw("8` Z Y ]]@ # ]@ /z,#    H ' ''''Ϟ#P'wssww] Z ]Y @ z$%%/zܮ጖ axwswww w w w'sw] ^] Y @ # ]@> $%/z `wswww w w w'sw] ^] Y %@ # ]@= &#/zL as'wvsw] ^`] Y ۟@ # ]@  #(/yh'swvvvvv awsw ^] ] Y Ϛ@ # ]@ݰ $#/yA  as'wvsw] ^`] Y ۟@ # ]@ ($/y┖ a`s'wvvvsw] ^`] Y ۟@ # ]@''''swv'/sw("cZ Y 2]]@ # ]@^ /t    ('  %'''''swߞ#w'sw]^]Y@ 3z /t    )&  %'''''swߞ#sw]^`]Y@ 4z #&/tͮP b`'swvvvvv v(/sw] ^] Y 5ϟ@ # ]@ °  # '/t'swߖ"cPwsw] ] ^Yϟ@ 6 z$" $/t0@_a {^`10 w瀢@ ` w)]@`@b @g] #)aw] H (b0_"s"@MZ Z  Y`(_Z B_Z X`_Z*@5X`8Z Y` €`` `?`?@ d@`x@w@4@^`@Y= o_:]k d@$8`o:@`6 @@ ^`]\ m d@<hf[`(o_Z  Z`(@ _ Z Y ( _ Z [(@_ Z ^(ƀ @ ( v^@"^J@.^_Y * ^`_Z*@X`8Z X` ^Z  @  @ @_ h"@Ȑo^Z(@o_ q ^_t^h#`$@ot   @ oV_@^@X@ X`Z @hvY 8Z`(@o^@ ^ Y @`Y @ @^ @J (vhr o@/sʐ^  8@:@x H5@N` @1'#h]  ] [ @T F@_ @% v @y B@_a '#b`]]Z@ Β @T @_g @5ov  0/r> wwߠ  @  # @  O ^*Z  '#!h] ] Z@ @Ts Д ^ ?i`d @_7> h&[( o '^Z X`(@ ^?ג ^Z Z( h '#a`]]Z@+@TI  @_  ' )/r]ᴖc! ww] ]  ap!xE ^@BX`Z( ^ ^Z [(@ .^Z X`€`H` @ ``@@]@W `O֔+')c!h]]\@  @S^ ? k d @^> h @ h ]]@ o#  @    wwww^Z X`(@@^Y @ Y  @@^^h v@Zoo^㾰/qѮㄐ @ Ȣ `$`H6 '''''G\@i`$ H6 '_'c'o'g'k_F\@"5\@ @% & & & &  &&`&`&`  &`&`\ v`0` `HC \@Z ]\`( Eh9@^N @\  H0t ?h-&Z X`@G@] Bnc*# )0@ *p&@`H)!]G#a@] o?\@Z [` 2O`$  o$`$# ` Ϧ/q4` $f> HB ` @```'''''@^*``@`2@ @ ] @ @Voـ`  @]h.H+ E^Z ] ( h$@]А @ w]h^Z X`@Go ` ```'{@'s'w''o ^oo/pҮ`@``` ( $c(b   '''''`Hw^]Z ^`^@]ss\@ @ ^Z [G@]: h^]Z ^^]ss[  o '` `0  /p\bb"'    H#P] $ H%^] Z ^@^`ss]\@ @^Z X`@π "@ @ "@ @\Ghh ]^[ [Z ]ss\@ oڒ '@[) HZ)@X@wwwwwwwZ(wZ(w('\) @]$)  '/p !Hb' $c`  H& ``` @`'''''w^]^`Z ^@ss]\@ @% ^Z ^G@\ h``@`` ] '''''w^[`Z [@ssZ@]  oْ (/oˮlw@[/w @ Y6$+^^`@X` K @\#@3] hA^Z Y @π` @:`@\5 h3 $+"^]ww'3$ww w w Z X`X@%`ss] ] Z@  # ?^Z ^oGϒ@3L]o^  @@/o_ἒ @V U6`@cʖ ZhKv, ="ƀ2\@0? ^ '@!(  @ '#] ]Z@ @Q  @[ِ h(  @$vh! ɐ3)a]`G a@]ovZ X`@G@[ h \ o @Zf ^@6` @1$\@ {Yh$\@ZZ X`€ϔ` @9`@[q h $\@:[ ?\@\Z [@G@[_ o۠ /n<@Z$w @ =+`$$+^@Z @h.$+@[}#@] h$$+^@Z X`G@[, Bj#*#@ +0 *p" 2H$+7)]@@?!@]?o& /nt@Yw @h =+`$$+^@Z @h-$+@[1#@t] h#$+^@Z X`G@Z Bj#*#@ +0 *p" 2H$+7)]@@ !@]?o&/n)w @ P _a@E]" -Z   -ww\Z Z`( W\- H o$ ^` wo^`ww``'v E5\Z [(@]\ Z Z( h@Z @a^`@`Ov`?o&\Z X`€G@Zm o6`^>@    E@  \Z [ (h$ @Z@2^`h v`^Z X`@G@ZC $ /m̒ @ 'b#'!'b#P?   ]]@OkY@@4h1w'ߺwwww]\_Z _ ss] ^]@ \Z [` @:@Y '#] !Ȓ ?[@O;]F@^ /mQᄒ @H  %" '`И#P   ww\]Z Y`Y@] ss^@] \Z [ ϐ @:@Y/m༐ @ ?'(#P  $`$"c  ww H'\]Z ^^] ss]^@@ H\Z ^ϐ `@;`@Yh\]Y`Z Y@ ss] ]\@o ,/lծ㔐 @̠ >'$#P  $b&"c  w Hw\]Z ^^] ss]^@@ H\Z X`ϐ `@;`@Y:h\]Y`Z Y@ ss] ]\@o -/lp @  (" 'b#P   wwww\]Z ^^] ss^@] \Z [ ϐ @:@X $/lWᜀ "HA@``` @` '''''`^%Z"@  H@"H Z  @6  @X̒ )]`@ 3#`@E]h% !В`@] o^Z ^`G@X h````  '''''D^o0 /l4"p'] `@ (ah )]`H !] @`H'!@e]h$^@q{^ 뀡`H;^뀢`hf` @!aؖ /]@(@X O (ah] o"^Z ^ ( G@````  $#''cPbH(/kԠ`  w'''''`H!w^]Z ^`^@]ss]\@ @^Z Zϐ  @> @Xhh ]^Z ^^]ss]\ oߒ +/kd`@``` & $#ccH   '''''`H w^]Z ^`^@]ss\@ @^Z [€ϐ  @> @Whh ^]Z ^^]ss[  oߒ //kऐ"']P^ZZ Zss]Z@     ^Z [ϐ `@;`@Wh /k @  $" 'b#P   w'\]Z Y`Y@] ss^@] \Z [ ϐ @:@W^/j< @w  (" 'c#P  \]Z Y@Y`] ss[@] \Z [ ϐ @:@W-/jxw @ )b'bPcPǚ  ]w\X`Z X@ss] []\Z [`ϐ @:@V/j[@Uw @O &b'bcPǚ #  $k$kw]\Y@Z Y`ss] []*\h$kZ [`ϐ G:@Vo/j b]ww^ \^Z  ) '"@cPss] ] [   \Z ^`ϐ `@8`@V'(#P/j $ b%w_bcX  ww''w H ^] [Z [ss]]^@@ H^Z ^ƀϐ  @> @VXh] ^\`Z \@] ss]\ o . ^   H @Vu@_ hw ^@Z X`@ϐ `@8`@V#^ __v@_vwvwwh  ^Z X`@G@V  $>/igܐ  H* `@``` '''''^ @ h'@V## @]ov^Z X`G@UҐ h`@`` `'w'{''o'so<^o``` @`/i'''''^o `@  ____vvvhv@U# @] h \Z X`G@U ``` @`/h''''' /^ #Z @!]@S 5)]3`@ a  @Uk] h@;] o\Z X`G@UH /h  ('b"cP 3 H>``` @`'''''w'^][Z s[ ]s[] hz$`` @``'''''^z'G``` @`'''''^˃z8` /hVᘐ^  /! #`Z  J@!@])!]@ @   @T] h@] o^Z X`@G@T  /h "'w]^Y Z Y# 'bcPss] ] Z@ߒ 6@ @/hL ^ `@@y ^ " <` @ {0pd  @ ^ @|^ )! 8]@ @` ]@Rf`` @M_f`oހ`?`?@ @ )a] @'c"H]  Z]#@I  @T "@@,] o'7?P10 ] @ @3m^ ^    @ v^^   '"X] ]^ @Ig+@T1@3P ^ Z ( ^ Y`( ^ Y (@^[`( ^  @y vh7o  0 H& `0` @&'뀢 H `  @1 `0`@2`h ^ [@^`( H  h  ^ [ ^` O 0@ɐ H& `0` @%'뀢 H `  @1 `0`@2`h ^ [@^`( H  h  ^ [ ^` O `H  ``@ h`?r@: @@RRZ+ &Z+@/f@RB`@@ )```H 8]@! (` ( H ]@!oq+  ?`0p @$@@@Q` H@P` H@%D``H@%=`H n` H@P @@Pݐ` H@P` H@%``H@%`H @#p` H@P @/f@#\` H@` H@P` `H @P 8)`( H`]@! @`"@3^ `"@^ `@@#0 H: `@$ H4 `@$ې H. ` @$Ր H( h& [0@   &@`@&`&` o&` oY 0@   @"`"`!@` o!`o@ )/eaH?`]0p @ @@P6 HH `"@2^ `"@^ `@`@" H9 `@"} H3 `@"w H- ` @$w H' h% [0@ "? v``@v`v` o&` Y 0@   ` "`"`!@` o!`o@/e.∀`"@e^ `"@D^ `@*@$= Hx`@"K Hs`@$3 Hn` @$. Hi`@$) Hd`@$$ H_`@$ HZ`@$ HU` @"y HN`@$ HI`@"R HD'`@ ]@ Z`0€  &@&``&`@&` &`&`&` o&`oY 0@  @"``!@` &` #`#`"`!@`o!`o @!@@@! H @`@H ``@h `@`O h2``@@! H`ف @@O-` H@O&` H@O``H @O` H@#a @!Q@@@!L H@`@@`H@ ``H `4 Hx`  @@!/ H@`@@`H@ ``H `@ & H@!`  @@! H @`@@`@h @ f``O @@!` H@! ` H @!m` H@!h @@  H `@``H@ 8ׁ @ Ξ@@?6 @" ` H 6 @"6 H`@" @ &/dఈ`] @` H @!` H @/dP ` ) H"]@ @ H`@  @x` H @ ` H@  @f H`@  @/cfhW ` ' H#]@h @ (/cSc] @'```H  ]@t` H@"W @ (/c6⨈c] @b$``h`H  ]@W` H@": @ ~@@@ y H`@ % @ o@@ k@@ g@@ '/cȈ`8]@ (@@M H`@M @/cx@M)```H  ]@` H@  @/cѮ@M ` ) H ]@ @ &/cȈc] @ @ H`@  @ $/c|`P]@ٕ @ @@@MV` H@MO` H @MH` H@MC @@M= H`@ @M3@@ $/bu㤈`P]@ @ &/bk|c]@ @/bbX@M ` $ H P]@ @ (/bO b]@Y (@ (/bE` ]@O (@/b<- ` ) H!H]@> @ &/b)tc] @U` H  @@ \ X$` H`]@E @/b @0` H@$```H  X]@*` H@o @ H`@  @/bX@ ` H @Ӵ $` H!]@ށ @ '/bɮap] @` H @#` H@  @/b@  ` ) H"]@ @@  H`@ @@ ` H @` H@ @@  H`@ @/aw㬒@ w ` ' H#]@y @/aed@L$`c(`H  ]@` H@ @/aL@L ` $ H#(]@r @ %/a9ⴈcX]@C (@/a0␒@ 0 ` ) H!H]@2 @@  H`@  @@  H`@ x @@ ` H @}` H@) @ @@@U H`@ W @@J H`@^   '/a0sswwP] ^ Y  @  z$p /w/a߮Ĕ @w__')ssvvah"H^`] ] Y @ # ]@     ' /a ''''vv p'wssww)Z bH]Y ]@ # ]@ΰ  ('/`hwswwww w aw'wws"^] ] Y @ # ]X _'tt t  '/`ZⰒb'swߖb8'wwww'sw_] Z ] Y @ # ],  %'/`4wsww@w`w`bww'wwws"_ ] ] Y @ # ]       (/`\''''swvvv'sw' bZ  Y]]@ # ]հ  ''/`ܮwswvvvcwsw"^] ] Y Ϛ@ # ]       '/` ''''swvvv'sw)"p`HZ  Y]]@ # ] ` w/_d @w__&)ssvvaؒ"H^`] ] Y @ # ]@     # /_Y''''vv#X'wssww)Z bH]Y ]@ # ]@v _ tt t &)/_,swߖbwwww'sw H_`] ] Y @ # ]       $/_T''''swvvv''sw)"`HZ Y ]]@ # ]c  ()/_ٮwswvvvb'sw H^] ] Y Ϛ@ # ]= #)/_ bpH'swvvwsw] ^] Y #ϟ@ # ]@԰  %)/^wsww@w`w`aHww'sw H_ ] ] Y $@ # ]  $)/^fwswvvvc'sw H^] ] Y %Ϛ@ # ]ʰ /^CT^`^@^` )wwwwww w `H'ssww %^c0] Y &]@ # ]   ')/^swv@v`v`cPsw H^ ] ] Y ' @ # ]z  #$/^wswvvv`'sw!(^] ] Y (Ϛ@ # ]l _/^̮x    _tt t  ''') bHaP'''swwwww'w'sw_]]Z  )Y@ # ]       $/]''''swvvv'wsw'!bZ Y *]]@ # ]^ %)/]f cPH'swvv'sw] ^] Y +ϟ@ # ]@   '/]DsswwP] ^ Y  @  z$ &&/]wswvvvbwsw ^] ] Y 2Ϛ@ # ]@  #)/]Dswwvvcsw"H^`] ] Y 3ך@ # ]@! ')/]ถ `XHwswvv'sw] ^] Y 4ϟ@ # ]@  )&/]q wswwww w a(w'wws ^] ] Y 5@ # ]@x _&tt t  &/\Ch`'swߖax'wwww'sw_] Z ] Y 6@ # ]@L  #&/\wsww@w`w`bHww'wwws _ ] ] Y 7@ # ]@# '&/\, bȒswwvvvsw] ^`] Y 8ן@ # ]@ _/\Юtt t  _$)w'swߖbȒwwww'wsw_] Z ] Y 9@ # ]@  %&/\wswvvvbwsw ^] ] Y :Ϛ@ # ]@ $)/\|L aВswwvvvsw] ^`] Y <ן@ # ]@  ')/[Vswwvv`sw"H^`] ] Y =ך@ # ]@ %)/[3( ` Hwswvv'sw] ^] Y >ϟ@ # ]@ _ tt t ()/[ swߖa ww'''sw"_`] ] Y ?@ # ]@  #)/[wswvvvb 'sw"^] ] Y @Ϛ@ # ]@  ()/[Xwswvvv`'sw"^] ] Y AϚ@ # ]@Z  ()/[wsww@w`w`a0'''sw"_ ] ] Y D@ # ]@2  #)/[q wswvvv`'sw"^] ] Y EϚ@ # ]@   ()/ZKwswww w aw'sw"^] ] Y F@ # ]@   ')/Z$swv@v`v`cPsw"^ ] ] Y G @ # ]@  &$/Z\wswvvvc8'sw"^] ] Y HϚ@ # ]@ $)/ZۮȖ bPH'swvvwsw] ^] Y Iϟ@ # ]@@ &)/Z4 aH'swvv'sw] ^] Y Jϟ@ # ]@  #)/Zswwvvcsw"H^`] ] Y Kך@ # ]@ &&/Zm `8swwvvvsw] ^`] Y Lן@ # ]@  #&/YGxwswvvva'sw ^] ] Y MϚ@ # ]@d  &&/Y!wswwww w `(w'wws ^] ] Y N@ # ]@( #)/Y@ `ؒHwswww ''sw] ^] Y OϚ@ # ]@] @@@@@@@P@@L@@H@@@_ @ Hd`@@Y @ H^`@* HY`@% HT`"@;^ `"@#^ `@``@? @ѐ HB`@̐ H=`@ H8`@ H3`@ 2O`h,Y 0ƀ  v``@v`&`@v``ov`oY 0@  `" `#`"`!@`o!`o @@e H`@ @ H`@ @/X0@` @ H)@` @ H!@$`` X`H@m]` Hr`(H @{`, H@U @ @@b` H \` H@B @@ @@J @ H`@E @K@@ H`@ @ @@+` @ H@#` H@``H @` H@ @ H`@ @ @@` H@ @`? H0p @ @ @@` H@` H @` H@ @ @@ɲ` H@ @ @@` H ` H@ @ &/W tb] `@` H@ @/W, @@` @ H5@$`` X H+] @r`$  `H @h]` H@}`( X H@X`0H `D H@G @  H`M @ H`@1 @@@@@@@ (/Wጴb?`]0p @b @ &/WTbP?`]0p @T @/W @4 H`@ H?`@40 H` @40 H`(@40 H`0@40 H`8@40 H`@40 @ H`H@ H`P@ H`X@ H~``@ Hy`d@ Ht`h@ Ho`p@ Hj`x@ He`@ H``@ܐ H[`"@B^ `"@*^ `@`@ɐ HL`@Đ HG`@ HB`@ H=`@ H8 $`  X]@z H.Q`Y 0  &``@&`&`@&``o&`oY 0@  `" `#`"`!@`o!`o @@z` H@` H@h` `H@a`$H @Z`( H@Y @/Vဒ@P` H@E` #? 0c` H10 ]@R @/Vݮ@1 H``@ H[`@ HV`,@  HQ`0@! HL`8@ HG`@@ HB`H@ H=`P@h H8`d@ H3?`h@ە6 H,`p@Օ6 H&`x@  H!`@ H`@ H`@ H $``]@ X H #`!`]6 @  @@ΐ` H @Dz` H@ׁ 0 'w/U^`@7!p^@  @)  ] @t 뀢@<  H^@^@^ |t'[P@ @. 뀡 2O^@h( ^ Z`H@o @v@ oԈ''ap _  Z]@@뀡 @' wh @_o@/Uἐ H %`a @ @J]@ @/UX H% a `@ @0]@  H@Ё 0 $w/UͮԀ`@7#(^@  @)  ] @ 뀢@<  H^@^@^ |t'[P@ @. 뀡 2O^@h( ^ Z`H@o @uv@ oԈ$'c( _  Z]@뀡 @' wh @R_o@/Tvxl H #`a @ @]@ @/T]T H# a `@ @]@p  H@? @?/T>☐@o4p H2`@i4p H,`@ H'`@ H"`4p @Y H` @v H`( H $`@`]@7 X H `H@ H@`\ @@`? H0p @/ @/Tp H #`a`@ ` @ @3]@@ (/T׮b] @` H@& @ '/TĮఈap]@ @ (/Tb] @ٲ` H@ @ H`@ā @/T@?`4p H)@`4p H!@$`` X`H@]` H@`(H @`, H@ @?0p @` H m` H@y @ (/SQb]@s @?/SG⼒40 @x`40 H9@p$`` X H/] @V`'  `H$@L]` H@a`( X H@<(`0bH  ]@1`8 H@' @?6 @36 H`@- @ (/Sdb]@ @ $/S<c(]@ @ (/Sݮb] @ ` H@( @?40 @`40 H@` H@``H @ ` H@ρ @ (/S<b] @ Ʋ` H@ @?@ȕ0p H`@ @?0p @` H@` H @ϲ` H@ @?@0p H`@ @?/R_10 @'```H  ]@ R` H@l @ )/RDⰈ`X] `@ c` H@Y @0`? H0p @` @' H`@A @ $/R`]@ ; X@ #/R܈a]@ 1 @ #/Rᴈa] @ $` H@ @ H`@ @ $/R<c(] @ ` H @1` H@ $w/R&bcw1%(] wװ!&@ w;73w]#]x"wb—xbw9)%5' ]w]]__Ǹ!X] $w]]]_]_ch]]_]_]]_]] ]__]] & H] srrt@tu@s@vvwq@@/Q<#)aX]\ @\@ aX@|+]\ @\@@| o@ )/Qq⨈aX]\ @l\@ @8 @ H L \"@L h 9 \ od`L/ `?@@ @ @X@@@ @ Hv@@ H X`@@ "@v ?Р /Q<@{/ ::`@2@{@{)!]@`@ 9)@c⠔] @9) "pw] 'w'_ @L_@ ?ϸ@ > 'cH]^*@_ 7^_ @ H&#'b]  Z]  @29?@ #9$"]_ @_@h_ ?`@]o9$ ]_ @_@`%5% '9#"] ^] @2 @c#`? @]$"]_ @_@h(h] _ @_@ O '& ] _ @_@(c] _ @_@ o#@@$ @ "HX`hX`@@  @   d@@@ @ "@v hv @@   @ `H @{@ Ԟ@&@@&@@ @ J@0w @6^@  @( ^@ 뀢@9 ^@ H Y ^ |4'[P@ @* 뀡 2O^@h$ ^ Z`H@o @{|v@ ?ׂ h' _Y`뀡 @' wh @z]_o@ q@@/O㌐@ g H @`@ @`@`@h  ` $`bH]@ `O @@ Ȑ` H3@ ` H,@ ``H%@ ` H@ `(H@ `, H@ `0`H @ ~`8 H  !/O H]Z @ @.@zo @ < @ @ H  Ht@] \c  @$]t@ /OЮPc]^ c@$]v@ /Ob]^ c@$]v@ /Oจ`X]^ c@$]v@!/Ol#]^ @#c@$] v`  @y]#] Z@ /Nzc]^ `@$]v@ /Ng㬈`P]^ b`@$]v@ /NT``8]^ `@$y]v@ /NA`h]^ ` @$f]v@ /N.Ȉc]^ b@$S]v@ /N|cp]^ c@$@]v@ /N0c]^ c@$-]v@/N#]^ c@#] c@$]v@ /Nᔈc]^ c@$]v@ /NήH`(]^ c@#]v@ /Ncx]^ c @#]v@ /Nఈ``]^ c(@#]v@ /Ndc]^ c0@#]v@ /Nc]^ }c8@#]v@/Mo̊"]^ c@@]v@ ?/@ @DC @#@/MH0#]^ cH]v@ /M8`@]^ cP@#]]v@ /M%⤈`p]^  cX@#J]v@ /MXc]^  c`@#7]v@ /M `0]^ ch@#$]v@v@@!h @%  @ @$Ӑ/MX@8Z 0  l "@Z H']]Z@ @/   @: hwZ PwZ XwZ `@w_t H_t P_t X_@xnt ` t @  @9hmא2   @¤ TZ  Y ( \`[( @ \ X*@?\`? ]3p @pm    @o t@\`[ ' cb ]]\@ @.+Ӕ @9 h0@S  \`Z @\`[ Go t 0  h  HZ`( o'#]]  @.\@9ox @@8 Z) \)@X@ X`Z €h t)Y 8Z`(@o\)ot)@@7Z 0" \ @Z*@>X`8Z X` @t 0\ @ 2 l H(P t @\) \*H \)(Vh$@vot*H@vot)@M(Ȁ O @G+@v\(`\(XZ8€W)o@vot @Z`(@o\ 0@Đ?t `t 8t h$ p$ xt Ht Pt X /Lݮ܂"(` @"0h] ]!"H8])Șb@] s] sss^ @ @$O >`@!@#@ /L4bX]"P@1`H ! ]#@@vJ] !] /K@#{w߲`x@"9] sϊ sss?^ @^ 0]0p _@o @#J_)] @h!^  @:]hb^i ^i i_ϰ# ]@)a] `@ _ϔ`[] [ [ @^ _@<@@v _h6_ @-^`X*#^i>iiȚi^i( '^iZ*@X`8Z [ @)vi]`@3^ o`^(@o^i`HZ ^ ( oۗ>@@u_o^`X@/K@6)!]  ?]t)$+$ l$))t)t 8 zt( )!8   @]h\)(P(a@]@˒h@*v@@6{r+r+@@6s Z)  Z)z\)t)\0/K ___@6Yw'#'Z 0  '#H]]Z@ @,’  @7 h )_ ?@uC*@u? ?\*H @2@u0t*H$(h$ t\*H+$$ t$)t($(@$ l $( ]t("@t(]@t(7)] @@ `?@ H \ 0Y@`@@4ؖ`]@ @ `?@H `\ 0^@@@`@T `@4 wwwwwww\*H;`w'ww'@w]@w_ǀ`@w`@\ 0 Z  [(_\ 0@R; "@\ 0@"@\ 0@@~`\ 0@Q "p\ 0_`( t(_`@ t 8_` @t(_` u@-#@ ,]_\(u__ l" l ~$`?`?@H$ p]`"\ 0hg"eZ _ (]  Eh\@[ ]@h"@5)]@ O ap@]o`)a]`@-x@w]@/4o '#!]  ] @+_@@]oZ ] @/G/@6r h@6!# @ ]hZ Z`/`H/#@   @ O:`/` "@wOoޓ:`_____'Owo'Sw_wwwgwW_O@P\ 0 ?Mo\ 0@!$_oE Z ^ (@' O:_'Z Y`@6 @ o0 Z Z( O\ 0 Z Y ( O\ 0 Z (p [`(Ā o\ 0\ 0 Z ^ (@ O`\ 0 Z Z(@ 2O` \ 0Z *p ]( o逤`_@ 'wǗ4D t)D(\(s\(ss\ @ssǬss\*H@H+\(>@ _h_'@ аwǕ4D t)D(\(s\(ss\ @ssss\*H@H\( )a]@`G7\ @h@] o`( @  ? )%P] #o}$ l_ o_@>"qB+i@ @ic')]@ $H5+^ aP@l]h.+p&@ + *!@ @ @ @2O'))!] @`@ `G2 \ @!`@M] o-^ aX\ @@F]o@o$(@s<o@@4  ,Z)v) /Hd@4 Z) w l "H\ 8 t @=(\ 8?`!\ 0 @ ' #aH]]\@ @*p  @58 h^@O @  E\ 0Z [( hM@5O #`@ v] o\ 0Z Z€G@4 o@^ O '(P@- \) \(z"@ )  &\@v \`ov `H) @'  oc!] ] Z@ @*  @4 o ot)/Hޮ@3 l @8Z 0*Z 8#'!c!H]] [ @)  @4 hBwwǖ@O<\ 0`@ h4@4א # @ q]h*\ 0Z X`G @4o@(Ȁ "H(P '#H]]Z@ @)  @4 oְ@ 2H o /Gd@3.vvvv l H-k 2H*\`0\i@'Ij\ihQ^*N  @4:oc!H] ] Z@ @)x  @4@ h9\`0'@O9\`8(@Z  @ @4X 5#@ S]h@s X\ @-ɒ @v&o @q @3 o\`0Z X`Go  /G @2 ' c!H  Z 0 ]]@)%[ @3 h $+\ 8@N \ 0Z X`€G@3Ő  /GۮԐaww w w ]Y Y#%wss`w'] ^] X@ Ϛ@ # ]@   /G0@2aw6` 'cZ 0aH   ]]@([ @3 h-&+^ 8@Oh# ^ 0Z [`€ϔ: @ @3ah ^ 0&+^ 8 ?^ 0Z [Go /Fi @2Z 0  l @56vvvZ)*@''#H] ]Z@ @(z  @3B h# ww'wwwǴZ)Ϙǒb _  @h &@po@/F"@1Ѧ @^  4  @2h @qސ#v`@&` HI;#`x`B@`@P"B]`0 @/@@)] @@!2`!@] `]@@o̐  @ \ Y`Y@u uq`` O `@]h @2`]@Ԑ@mhu]`0Z ]``G@2 o]@q-- '@w2^ @(p@[ ,s`s Z`rZ@r Z`r r  O ;#`]  ]`8@N#]`0@_o`] og @qh-? '@wǻ2^ @/p[ ,ps`s Z`rZ@r Z`r r  O ;#`]Ր]`8@N]`0@OoN/EG@0 w'dvvvg`cw'1 oZ 8@M\ 0j @b  H )Z @aX` )a] `@!!]@  @1@7#@]hL g  & `@e@6@p͐)@&v^` )0@ @g#`^^t tv@pؐ Xt   @+^ @*o^o@] oÒ 5#@V] @1 h@1 o\ 0Z X`€Go  /EP@0i 'caH  Z 0 @ ]]@&[ @1 h%@MaZ 8@  @  B$ xh@1# @] h \ 0Z X`€G@1d o /D{T@0* 'caH  Z 0 @ ]]@&[ @1] h%@LZ 8@  @  $ xh@1v# @\] h \ 0Z X`€G@1% o/D<X@/  x`B``?`?@HA@> Z 0;'w\ 8\ 0@L" '# @)]  Bh)$ xw\ 8\ 0@L" \ 0#` @] o Z Z`` @?)!]@ @:`@] h o$ x@@/>>r P Hr Xr `r HZ 0  @\)"\)Z H @  \) H @X`[(hX`[`(o\)X`Z(@o\)@@/kZ HvZ Pv Z Xv Z `v 㾐/D@/Z^I`H`)!]@`@@`] `H#^ Ɛ\  \ \^\XHZ [( ha^ ]@nߒ^ @n! "@"H a]]a]"8] 0s]  ] ssssssss@s7 w@E !sǒ? s2p ]ss _@gn 7)]@Z @~]@_h<_[@ _1)!]@`@*_ b!# @]  )!]@@ %_^@]^`^`@~^ _ @ @_os@]@m_o[`![`@~]o_@@.)ȁ@@.Z @@@.Z(@ (/CЮਈ`]!@@@.xZ))p/CT@.j@ww6`D t)D(\(s)\(ss\ @ss׈wss\*H@A\(@l_wh#?`s] 20 \ 0\ @_w@kr '#_ww] w@ے`@I)`@`) )]]@ 1  ] @~8] ] @w``?`?@"H$( $(3_w`@]Z     ]]@_w H5()]`@ # bP]$5(]`H3#bP]#_w`@v] %Z  %]@l_w Z   _w!@b] `Z @t+r `gssss] ?4p \ @\ 0_w@f< ))!] G^^ !@}]oX)_g ;]@)]@@ _ga\@]\`\`@}^ @_w_g@@@l_gh_g @g\ X*\\)( H _w% o@_w@5)]`@3Z a@}u] Ph )'!a]]  t)$ lt)\ 0@ )X@*#Z 8X`] t 0)?t 8]  @y(Ȓ @Ք \) @(0\)a ]\`@}@]hfY`(Āo\ 0 H\Z Y`(Ā o(@@l)_go\ X@  o>t+@  o0t+@} ] o #mso O_o )* !t)]@G^ ؔ`]@}\ @o)_w ]@|)>ʹZ >ː` ]@k  H    @k]   f` )!]`$O`Ȕ @|]o`0/A !%&) !h?]  $h $h $h $h $htithtititi ti(ti0ti8ti@tiHtiPtiXti`tihtip@kktix    '/''#'''+@l th\iJ+ih}_o__'/th$hththВ @l hP/#" ] "#" '" +" th`Ð_'_w/w'@; "H\i ("`]]\@ @ $`h\hX\@ @hhA @ h<  @-j h7@Fi[` @_\i  @lk ?ti "`!]] [@빐 2O\hXo _'w/w'߀ "O\i 1'b`!] ]  @^\ 2O\hXoɒ @+) H@ H^ ''' ''w'w'\) @.S$)  &\)@/@%@+԰ )Z+(\att(] `@  \`H@.. h$@R@R\@R\!\ @{]o@@@/@@F` H6@?` H/@#``H(@` H!@*f`(H@*X)`8b  H@]`@`H @`H H@*N @@` H @` H@ @ &/?㰴bP?`]0p @ @g@@c@@@^ H @`@ @`@  h  `H @* `@*`@@D H  @ H ` H @@2@@@- H  @ H ` H @惁@@@@@@` H%@ ` H@``H@X`H@Q` H @)`( H@ @/?t@` H/@` H(@``H!@'`H@ ` H@){`( H @д X$`0 H`]@ @z` H@` H @`( H@ @a` H@` H @`( H@؁ @@{ H`@)/ @/>㔒 ` % H#]@ @/>L'` d (` !H H ]@́ @/>zɴ X` $ H#]@q @/>hⴒ@b`  #`"X ?H10 ]@奁 @@z` H@1` H @*` H@% @ (/>9a?`]0p @} @@d` H@r` H @k` H@f @ #/>\c0?`]0p @V @/>(`  &` " ?H10 ]@B @/>Ԓ ` % H#]@ @/>ޮw 8` & H!]@Ձ @/>̮De X` $ H#]@Á 0 &w/=`@=" ^@ `@/  @] @% @' @J ^@H (Y ( ^ {'[ P뀢 @9 뀡`2O^@h3 ^ \Ho h* @i6 0v@% oΠ&'b  _ \ (]@p  @뀢 @' wh  @h_o@'o@/=QX 0` ) H"]@H 0 'w/=<`?@9 ^@ € @+ 4p  ]@v 뀢@? ^@ H Y ^ |'[P@ @0 뀡 2O^@h* ^ Z`H@o @hv@ oҔ''` _4p  Z  ]@?뀡 @' wh @g_o@/=@  8` ) H ]@ׁ 0 (/=̮Dw`@B!P\ @`@4 咒 @,`@ @'`  8@] @N \H (Y ( ^ xt'[ P뀢 @= 뀦`2O\h7 ^ [HĀo h. @hE 0t) oɲ' _T^`(` @뀢 @' ?wh @g _o@ `  8O@g]o0 #/<Z|w`@B"h\ @`@4  @,`U @'`  8@B] @N \H (Y ( ^ xt'[ P뀢 @= 뀦`2O\h7 ^ [HĀo h. @gӒ 0t) oɲ' _^`(` @뀢 @' ?wh @f_o `  8O@]o@/<༒@)```H  8]@ߴ (` ( H ]@ׁ @ )/<ͮH`]@̕ 8@ (/<î c]@• 8@ (/;aP]@ 8@ #/;Јbh]@ 8@/;㬒@&+ 0` ' H 0]@y @e@@-@@/;D@X 8` ( H#]@ @/;z@G)`` `H@p]`( "0`H ]@A` H@H @/;Wp@$)```H  ]@L ` ( H"0]@  @/;;@% 8` ) H" ]@ @/;)Ḓ@'```H  ]@` H@ @/;T@ݐ$``h`H  ]@` H@ @/;@ô ` $ H#]@ʁ @/;਒@ ` & H!P]@ @#$/;T`]\ @k6\@ `&`]\ @k*\@ ``]\ @k\@ ``]\ @k\@ `@)J@/:d@!B"q)0i@ @4ic'@@T "H)'bp]  Z] @+ @uT\  /h-  bxo]a]@ $O "@v] @ $O \ @v o+p$@ + *!@ ` O)!]@`$Oװ bho]0 /:b؂ ]' @ '] @nV\] Z" 3`H@e+ @@#3+c8-];'cH#%)c!bв "'4   @ΐ` '] @@u]@ `O4 ;b]@n{\ a ΀_3')c#] #]@\ @& hOw@ee]@rt@dߐ 2H0]\ _ ( "뀢 H ' ' #\ Z(@   @q ?t\ [` ƀ ]] +@^ @& o?[]0p @]O o@n#\h  @m]  ob$@ /9L@cH]q@@ /9Ac]@: @ /96c]@@ /9+⼴c]@$ @ /9 ␲c]@r@ /9dc]@ @ /9 8c]@\ /9"L#(0] @v]  @K}@ A @h@L_@ؐ 3_"@5'X` @ '#c ] Z]@##ߔ @% h@*X`v@|__@_h 3c ] #]@ [@o #8]Y@ o5' /9ਈbئ]@ @]!"] @m\#8] Z@' 1#(#0]@] @K@~ @mI\hD@_@K@m ?_ \@m43c ']c ]#@\@ @% h"@m _Z 0r 0_Z 0 @ r 0_ג @K @m\@{_@_h"@l]  o$@@ /87bئ]  @B "%!"]@_b@_]   |dz$@ @&%]@lY@@@@ @M]@l\@h@אo@o@do    o%@l(]  o$0/8w C_ ߐ @6 \ ?@H_@E_ b @ J]@bw &_ ߐ @Ò \ ?@+_@(_" @ -] @bh  G@BGo\G@=Go\0/8\w@ C_ ߐ @6 \ ?@_@_ b @ ]@bfw@ &_ ߐ @v \ ?@_@_" @ ] @bIh  G@Go\G@Go\0/7E$0p   @F 5 "Z Z(@ H # ' '\ [(@   @ cߐ@t]_\Z 8Z`(\ Z `2H<`@<`h @| o\\ ^ € o@/7ؒ @a @ab]@c 'c?b #@ ]]@'[ @# h@b @&@@b&h o&@ /7c8]\"@ X@ X`[ t"]\@ @ahtY 8Z(@o\@ /7\c]@@ /70c]@0/7}#(0] ]  @+  @ #@] @zWY@@\@Z )'c c _@#1'%# X` @ ]]@^@ @#i h@X`v@@y_h  ][@]o @ /62؈c@]q@0 /6'@'뀢 H# hA b@\]@:|h7G1@] Z b@ z]" Z  b @;% ?  |4xt@ b@q@yb@\] o ] @ q o ] @ k o@ o@0/6׮lb(] @ O] Ⱂ @ I] #@ ]@yY@@ @ _| /6В("] @ *] c8 ]@H.\@@   "@ ]\@@H_@ @__ױ|D @ /6?) b @`]@`}^@`J'`  ?  ?@a0  )/5a㔈!]@`@Ȕ@qJ] wN`@C ,_ ߐ T5 ^ ?@@wN@`@ ,_Aߐ @ ^ ?h6G@Go^@`g ײ @,"_L O ,o_@o_G@ɲGo^@`M  @,"?_L  O ,o_@o_@r@^) ^   2H ^ ^ " ^ Z*@X`8Z X` €^ " ^ Z*@X`8Z [ @^ " ^ 0Z*@{X`8Z X` €^ 0" ^(XZ*@lX`8Z [ @^(X*@aX`8^ @ Z^) S^*H L^) E^)" ^)Z*@:X`8Z X` €^) /^*P*'Z ^+x ^+ ^+ ^+ ^+ @_@ ov+@o^+@_xo^+@_to^+@o^+[ 8o^+x)o^*PZ`(@o^)Mo^)@_Zo^)@_Vo^*H@_Ro^)(Po^ @[ (o^ 0Z`(@o^ [ (ou^ Z`(@of^ @_6oY oR^@/4+@ װ ?2  (P& (v 8v+v+@)v+ (a]@&q@@ (^ @+^ @hr^ @hp^@_@/4ӮP 0@ǐ @hI ( ``]@hCq@@/4 "@^ %!hP] @] & x`& |`& ` & `& & Pv @@B+@@"+@@B p@@ Z)y4@@Z @@@r+@@Z+@@Z+@@Z+@@}"+@ )/4l! '] c"] !] X@  @ܰ@a0@  @ __Z X`8@0/3ҮȊ"ؒ] @ ] " @ ]?@wK0p%@ P@ N  _*@wh\ @ ]"\Z  \*?\ @v_h_@o\ /3ؒ@9 @l b@] H@f H_hZ%И] @ ]  ]  @ ]ߐ?20%@v__Z X`8@@ @  _*@wh1 sn^`0_]@ W\ ]@ S\ @\`  \*?]@vr_h_@6 2@ \`\`@]  2O\\`@f o\ @;@/3p1w#צ4p   @!@^qĀ\[ _ H' ch]] ^@'@mh@v)o@] 2@4p @@] @@] #w] 0p @]@c@ ]  @]6#]@ ǒ  @._@ Q__ 1#] L@`@#] ?o@ƒ ? #@]!@o#"аX] @] wǢ#` ]@_ǖ @v_@ _@ _Z Z8@ _ yt|d"O1Y`@ ?wZ 1#פ 4p   @  ?\\*? o1א0p   @ ?Noy @  ?Eoh /2Io_> @] 1p #p ]@ސ Z Y @h ߖ"w7@:ݐ׀ @ wϔ _@IW@\_h@\_@\o0/2w@w>@:瀢 H@@\|_@\_h@ m 'ow#cx]]Z@ @ݒ @l@] [/2 @XZ+x m # ('] ]P"] swws0p    @ "H]+x]+xwu+x]+x+#b!]bЪ"_ @>@W \ _]+x"_@u+x_"7_Z ] 8Āh1_ה ]ws@ ] @ @u_@ @ *\_Ґ @t@o\X`Y`8@o@ou+x@ /1fb] @[ @]  @[ @㈔ ] @[ @7㐔 ]@[ْ @c ]@[В @c ] @[ǒ @5 ]@[ @7㰔 ]@[ @# ] @[ @5 ]@[ @{7Ȕ ]@[ @m]  @[ @^3cؔ ]@[ @O # ]@[ @@7 ] @[v @2 ] @[m @# # ]@[d @ ] @[[ @ ' ##] Y@@Dy' ##o]3'c] o#' #o#' c o]1' #]o ' c o] ' co ' coٴ ' 'o] '  o] ' # o]1' # o]' o ' #o 3' co ' # o] ' #o @ /0V؈`] @Z @r]  @Zے @d ] @ZҒ @V7  ]@Zɒ @H`( ]@Z @:`0 ] @Z @+58 ]@Z @7@ ]@Z @ H ] @Z @5P ]@Z @7X ]@Z @`]  @Z @Ր3`h !]@Zx @  p ]@Zo @7x ] @Zf @ ] @Z] @   ]@ZT @ ] @ZK @7 ] @ZB @p ` ]@Z9 @bਔ ] @Z0 @T` ] @Z' @E7ด ]@Z @6` ]@Z @(]  @Z  @Д ] @Z @7ؔ ]@Y @` @Y] @3` @Y] @a @Y] @ @Y] @ ]  @Yђ @5(]@Yɔ  @a8 @Y] @3aH ]@Y @z7P @Y] @h` @Y] @V7p ] @Y @Gax @Y] @5 a @Y] @#ᘔ @Y] @a @Y] @5]@Yw  @aȔ @Yo] @ې3aؔ ]@Yf @ a ] @Y] @7 ] @YT @5 ]@YK @! @YC] @ " ]@Y: @ @Y2] @n7  @Y*] @\"8 #@Y"] @JH (@Y] @8bX @Y] @&5h]@Y  @ bx ] @Y @ ' #]Y@S@D '"p#] ]^@#o 7'b`] ]Z o# '#P]]^ o+'c@]] Z oִ+3 'b0#]][ o̴#' b] ] Z o´#5' ]o#7'b] ]Z@ o#3'#co ' #o]' #o] ' o# 'К#] ]Z o# '!c] ]Z o# '#a] ]#o~Z'#]]Z ot# '1#!] ] Z@oj#'3a]]Z o`#1' ##oY] 'c!h] ]^ oP# '#!X]] Z@ oF#' ##o?] 'a@]]Z o6#7' a0] ] ^@o9#' co&# '1#!] ][o#5'] ] Z o# '1# ] ]Zo #'`] ] Z o# ' #oT#3'c] o?' #o#1' ##o]5' ]o#' oݴ# ' #o3#5' ]oӴ#' #ou ' #o# 3'c] oô ' #oe ' co 1' #]o#' c#o] ' co# ' co#'  o] ' o ' #o 1' # o]' o/ ' #o 3' coز ' #o:# ' #os#@/,ҮȊ" ]@W_ # ' c `@+] @WP#'∔ `@] @WB#'␈c @ ]!'@W4 # H#]X@@o]/,' "b^ @ X`@W] `@@W ]  @ @-o @th@ f^*?^ @ !@V 6 @X@@X @V@@ِ@VӐ@Vѐh? @ /,;lb@n] `H@8`@ /,( b@[]:  /,""']  @/]⸢] @) @@@@ h0_@- X`@Z ʀ_@ s] \   @ @`_@o= h!# ]@ko_?@V2 ?o0 /+Ů㔒"Д" ] ] @ b ] @ @ @?@=@h _@@X`_@nб<`@/+@ @`  @  l\+x+x @@h @odoc ]A@@@Z*P@t*PX`Y 8@,*X /+܈c(?]4  @Nې  @U!hϒ @ hV@UƐ@V :*  :@V*  @W ݉2p `4 #0]  @N ǘ8wǔ@] 1#H@]@cP@]  @z_Ǧ@_h  c@@Ul]o%!ݞ@40 ]@UbǂcHoڔ@@c@a*X@Uɒ @jP\jP>@nd\PhhvtjP o>[@UHojP@@3@1*X@U @jP\jP \PZ X`@9hGtjP o\P,@UojP@@@*X@Uj @jP\jP\PZ X` @htjP o\P@TojP@@Z*P@@"+ @]@ @X@0@+ H%^@w@瀢 H) _^`v@w@瀢 H _v`^`w@Ӓ߀ H @_h ov`@C H `@= O @@ + @$+: $+@@u + @$+: $+0@fw @8+^@  8@* ^@>< @G 뀢@< ^@ H 0Y 0^ z'[P@ @- 뀡 2O^@h' ^ Z`H@o @UMv@ ?Ղ h< ' _Y`0 @뀡 @' wh @T+_o (/)Ј`(]@l  Ht @J` 2H 2@8` ` `,''ǐ@扒ˀ H` @惒ǀ HZ @hT @5$ǞHv`v`(]&` &` &` &` o&` Vv`(: `$. v`v`v` ov``,^`^`''wwo'@Q H$ `@楒 H `"@``(@@h@{'&` @o&`#6: `$* v`v`ov` @@" (0/)@  ( HnZ "\` ` "@bZ \` *ZZ \@t`$`` $k NĀ@at@@}  ݖ 20 @> t` @q \`F "Z [`(뀢 @'\`   @` v\`Z*̀Z Z [`  'c#h] ] Z@ @ +@crh t` \ (@ h  # '\`Z [(o\`@S/ot@Z @ot` X` @o\` @@ ( HZ "\  `@\ @$+t h$ X`Y ot Y Z @o\ @@Z  `@\ @ \$ t $+  @ht@RotX`Y €ot Y Z` @o\ @@ \ + H!\ @5 -\ "\   "@Z \ *Z t $ $+o`Z €ot Z` @o\ \ @5"?\ h \ GԀ` d@ 0`oˢ`@@y>  \ "\ @3֖ &\ "\   "@Z \ *Z t $ $+o`Z €ot Z` @o\ \ G݀` d@ u0`oԢ` /'@@ www\ <@ @ƀ0\ @5 \ "\   "@Z \ *Z t $ $+o`Z €ot Z` @o\ ƀ___vvhv!# ]@h\ @2ږ oz\ GÀ` d@ 0`o`@@ ( H0 \ !\ @1;  &\ "\  `"@Z \ *Z t $ $+o`[ ot Z @o\ B\ Gހ` d@ 0`oբ`0@ ( H3  \ $\ @3 _\ "\  `"@Z \ *Z t $ $+o`[ ot Z @o\ h v \ Gۀ` d@ 0`oҢ`@@{ ( H. \  `\ @%\  @0o \ "\  `@\ @ t $ `O$+hX`[ ot Y Z @o\ @@E ( H. \  `\ @%\  @0c \ "\  `@\ @ t $ `O$+hX`[ ot Y Z @o\ @@ > \ .@c H!\ @2  .\ "\   "@Z \ *Z t $ $+o`Z €ot Z` @o\ \ @2, "?\ h Y\ Gр` d@ 0`oȢ`@@@ H1 ( H- \  `;\ @%\  @0: \ "\  `@\ @ t $ `O$+hX`[ ot Y Z @o\  /& @ ( H4   w'wwϰ 'ݤcp#x\ @  @{ (4 @ \  @/ \ Z X` € Ot h]@Zv`  Z [`(]o\  /%ͮ@P ( H3 wwww 3ݤ#pcx\ @ @=6p  ( @ \  @/ \ Z Z @Ot h]@O^v  Z [ (]o\ 0/%@ ( H1 ww 'ݤ#pcx\ @  @4  ( @ \  @/ΐ \ Z Z @ Ot h]@^@v`  Z [ (]o\ `@''@PG w'w'wϺ \ ,@! H \ @/  -\ "\   "@Z \ *Z t $ $+o`Z €ot Z` @o\ \ @2Ԕ "?\ h \ GӀ` d@ 0`oʺ`@@> > \ 2@ H#\ @/  0\ "\   "@Z \ *Z t $ $+o`Z €ot Z` @o\ \ @1 "?\ h \ G̀` d@ x0`oĢ`p@FƀD''@O 'ww'# \ ,@ H \ @/  3\ "\   "@Z \ *Z t $ $+oZ €ot Z` @o\ \ @2^ "?\ h\ GӀ d@ -0`oʶ '@NҔ ow@@>  \ 0@I H"\ @/h  /\ "\   "@Z \ *Z t $ $+o`Z €ot Z` @o\ \ @1B "?\ h =\ Gπ` d@ 0`oƢ` 'wwwߐ @6'Ӡ'www \ .@ H!\ @/@  .\ "\  `"@Z \ *Z t $ $+o [ ot Z @o\ \ @1  "?\ h \ Gр  d@ 0`oȸ 0@^' ( H/  \  `\ "@&\ @1*\ "\  `@\ @ t $ `O$+hX`[ ot Y Z @o\ 0 /#0cX ]  @k-@5Y  c`] @_\ @&h |  "@?\@,O`0!\  \  ^ @ t @^ ^ t $ t _ $ (hBt @Mo^ @Mo\  `o]"֪ (`(&OѪ2OϤ\ ]` 6oʤoǪ^@ o\ ?\ ?@M^  O\ @N'^  O ( h $ (` !@M]  o$+耡 H$ @10^  $'^ Z X`(@ˀ`@ ?h&+ h&+^ Z Z€π @?h+o?  `?@ߨ@@ߤ@@@@@ H`@ @ߑ@@@ߌ` H @ߞ`? H0p @Ł @@} H`@ρ @@ፐ`? H0p @ୁ ?0p @ঞ@@/"H@V H @` H"1`"*% Z@˓````@p`h ʓ`?1p @|`@?40 @Y`40 H@Q` H @` H @@@?@940 H `40 @2 Hy `"@W^ `"@6^ `@1`@ݐ Hj `@ Hd ` @ H^ `(@ HX `0@ސ HR `8@ؐ HL `@@Ґ HF `H@̐ H@ h> Z0€  &``@v`` v`  @v`(v`0v`8@v`@`ov`HoY 0@  `"`` !@`$ &`,#`4#`<"`D!@`Lo!`o@?@߰40 H݂ `@ߩ40 Hւ `@ߢ40 Hς `@ߛ40 HȂ ` 40 @ߔ H `(@࣐ H `0@ H `"@^ `"@T^ `@O`8@3 H `@@F H `H@@ H `P@: H `X@4 H ``@. H `h@( H `p@" H| `x@ Hv `@ Hp `@ Hj `@  Hd `@ H^ h\ Z0€ 4' &`8 v`@` v`H@ v`Pv`X`v`` v`hv`p@v`xv`v`v` o&`oY 0@ 4' `8"``D !@``L$``T #@`\ "`d @`l !`t&`|#`#`"`!@`o!`oS@݇@@݃@@@ݗ` @ H@޼` H @o`? H0p @ޯ @d@@?4p @ޣ`4p H5@ޛ`4p H-@ޓ`4p `H%@ދ` H@p`$H@B`( H@ݘ`,`H v`@ H@V @?4p @b`4p H5@Z`4p H-@R`4p `H%@J` H@/`$H@`( H@W`,`H `@ H@ @/ X@5` H@;` H @д X $` H`]@ @@ɐ` H @ܻ`? H0p @ @@޶` H@ܤ?`6 H@``H 6 @ڵ6 H`@Ձ @܊@@@܅?` H 6 @µ6 H`@ݽ @@|` H @u` Hv?`ȕ0p `H@ݠ`ЀH v`؀ H@ܶ @@S` H @L` Hi?`ȕ0p `H@w`ЀH @ܖ`؀ H@܍ @@*` H@#?`4p H@V`4p `H @N` H@^ @?0p @A` H@ ` H @` H@ @?6 @&6 H`@  @@ߐ` H@` H v`Ȃ? H0p @ @@Ő` H@` H ۲`Ȃ? H0p @ @ %/B`c8]@ٮ 8@ $/88b]@٤ P@ #/.a8]@ٚ @ '/$b]@ِ @ &/b]@ن @ $/㘈bx]@| @/t@` ` ' H"]@k @/,@N ` % H ]@} @ (/c]@N @ &/خ⸈bВ] H@A ` % H ]@9 @ &/®`b]@. H@ &/8` ]@$ @@?`6 H@I` H @6 H`@= @ #/ᤈa8] @ ` % H ]@ @ )/}L`]@ @@ܐ?` H 6 @6 H`@  @ &/_Ԉ`] @ȴ ` # H!]@ @?6 @6 H`@ @ #/;Dax] H@ؤ ` % H ]@؜ @ #/%ax]@ؑ H@ $/Ĉc]@؇ @ &/㜈`]@} @ (/tc] @p X` $ H ]@، @ (/c] @Z X` $ H ]@v @ $/ۮĈc]@G @@:?`6 H@l` H @*6 H`@` @ &/0`]@" @@?` H 6 @G6 H`@B @ &/Ḉ`] @ ` # H!]@ @/d@ܴ ` ' H"]@ @/@` H$ @` H @)`` 8`H @]` ( ( H @]@ @@l)@` Y@r)Y`r)Y`r) Y`r)(Y` r)0Y`(r)8Y`0r)@Y`8r)HY`@r)PY`Hr)XY`Pr)`Y`Xr)hY``r)pY`hr)xZ(`r(@/@=Z(Z)()!@)(t]`@`(2@O^)\)^)` Hgv)'!X]Y@@h`^) @:^(XZ @ @(P) @'hSv)#c]][@ @ @WJ o&)  @ "O) (^)t^(?) 2H5v) '##] ][ @b @W+@ Xo wh!v)j  "?\)2O\@ G o&)@.@.\@.^(#] @W\ o( @@(P /qt@ (P ) @k)()] @Z ^$P H" |\xw\w'\p@``@6t` ZZ$`H!i$`(t`@t`0t`8t`P@ @"!\ƀ$P H. HA h?$ '] @Fxo 'c] ] ]@ٔ o ot#@]@G? ?t`  @| o@.I\ c\@W[]o )!]@`O@WO] o: P-)/XШ] @ע(P\`\`#\`60 t`\`t`t`t`\`Z @"@   @ 2H  @FQ$`B@9 h`@*G?\`@-\`#] @W`c؊`]wwwwww'w/w71`$`@Eڐ@E ?#@Eې@Eߔ\a @zѤ?!ta  @E`x\`p)Ȧ @Fwo#w@F\a`h_ow'k\``)'ˈw] z])ax)a;`kj )0 "@@ '`@^ @V]@Đ oc#]  ] \ @ axa@U^ $`)# ]"\`hC ' @F _ot`pt`] `x@`|```"" " " G"   @m@-\`pa#@Vt]h@Eloڒ @Eho}\`c F2 @-I\` cȔ]@VZ\ao\`/㈀Hv@^ Y @ @T'ː@אˀ H ^ Y @ @A&   @`? H & @E ^ H" v`(^ ^ v` ^ %^ ?6!@h!cv`^ c10 FD)] @%^`(j<c+p!" ^` ] )p!x"s@V hc20  ov` @ 2O o  @ o'0ߐ    6 w@Lw@@"+/@ В1#@Dwא'@D wLj 'o  H@@, o) "@]^ @ ]" @N@`2HN` . /.. h/.  `@``$@(. / :H. 8`@Eϔ@I@`@``Oh.`G@ : /.o O8`o.@E ( @_Z` @@  H_&@ &`\v`v`Z €"&`\\`8> h @D2o\@D^  @Sn"@D  ^ @ȏ` v@v`v`v`v` v`(v`0v`8v`@v`Hv`P@ϐ_> Z 8@ v@ v`\ &`v`/%<@`@`@٢``H ^`@@  {4z"H\( &Y1p@ "`\(%)]@ @'H@T]hڰ "@ \))$`\(t`\(t@t`\) @  ZZ\`@!i `'֦ &@@ @z`)a] @ @T] ^` &Y2p`Eր`-` `) )!]@`@` @T]h> !]@`@+쀢H\`t`@k t`d` 2H> o)`@T]o+')]  @ n O쀦 o̰  ]@Tjo')]  @ wwwwǐ "O @ݒ## `d`]@֒oƀ  ]@TFo@r O)`@l 2O^`o~)^`@2oq )] @ @ogv`#@T&] obv`@oW@ v@v`v`v`v` v`(v`0v`8v`@v`Hv`Pv`Xv``v`h@W 2H@)a]`G.8@T]h H `@) @ `)!]`G!o @@ O) ^` @@  xtytH  &Y2@ 2o%) &Y3p `')ր@`֚@ ` ֔ @ `! &Y@40 @  {{$ @U ֲ `@@ xd~$@"H0wϒ`@+ @ ` ] '`Oh @W H в]`@#@S]] `$H> '\` @S]h> `` \`''www@Uϰ OݲВG#@]oπ @ @]'oht@@ג @ ] @`$@T oL pt`@ǒ H ]xot`o^`@В 2@`oA@ɐ O<В`@Ԯ 2Op^`o4] O[  `@S] oT^`]`OK X@S] oD^`]O; `P@S] o4^` #`` @J] /@ܠ  ߒ `H"'D'〢 "H @ː \i d` ) H!] @ @ (@R]h od`'ے@o@ : @/@$ $b]`^^  ^ @X@ @  @A^ @A2o^h @AoYo^ @*  @B Y\v\  \  h ?v h @B ?v \ @BIZ@^ q^ X@*\ o ^ @af/Ѐ`J !f`=!f  z y4@ @ 'c0]   ]@\^ @Qp^ @"@N @A=hJ  @@ ^ @` H^ P@Š @ _Y 8@"@4> @A#h0> ` o\`( `af O 'o@u 0@ t@t`t`t`t` t`( H @u^ PF H__Y 8@oZ8€o^ @/' c^ @!f `0  `  ]] [@> ^ @Q^ @h! H@C^ Pv@v`v`v`v` v`(Fj_< Z 8€^`(@ ` H`v @` ^`(& Hv P@/ @@C H0`@> H+`@$ H&`@ H!` @ H`0`(@q H )`8b]@Ӕ  H `@@Ұ H`H7@]`P @7 @@` H@``H @ @`@>` 0^@  @Bw^@@B ,p?10. @ @uw簒 H `H  _3p @0`@Bv@v@:  `@@@Ӈ@ `@@ `@@@җ@@@I H`@D 0w? @7^@  @) ^@40 @W 뀢@: ^@ H Y ^ |t'[P@ @+ 뀡 2O^@h% ^ Z`H@o @@v@ ?ւ h' _40 Y`@%뀡 @' wh @?_o0 & (w/ `@?#^@ @1  @] @'  @] @M ^@ H Y  ^ |'[P@뀢 @< 뀢 2O^@h6 ^ Y H@o h- @@v v@( o̠ &(' c _ \ ]@Ϯ   @ 뀢`@' wh  @?K_o@ϙ]o@/L` H)`b `H@}]` H @X`( H j@@&/☐ &] bx@ @ ("] @@ @@# @ry] h] @@]o(@&/Ю"`]&@cH`H 1(] @@]  `$] bXZ] @rU  `][@(/lH '] c(@ @ '!] @@y W @@y' @r.] h] @@v]o'@(/h #] a0@ @ '#] @@N ~@@N%〔 @r] h] @@K]o'@ (/ZbВ @@E] & H!)] `@@?  @Oa] o]#@@/;N &b]!@@ '/-`a @@] ( H#H)] `@@?k  @O4] o]#@@ '/ c @?] ( H#h)] `@@?K  @O] o]#@ @e@@`@@`"@_^ `"@D^ `@ @% Hl`@  Hg`@ Hb`@ H]` @ HX`(@  HS`0 HM`8@ HH`@@ HC`H@ H>`P@4 H9`X@/ H4@*``Z`0€  v@`v``@v`@v`v` ov`(oY 0@  `"`  #`#`"`$!@`,o!`o @`"@3^ `"@^ `@@ϩ H: `@ϣ H4 `@ϝ H. `@ϗ H( h& [0@   v@`@v`v` ov`oY 0@   `"` "`!@`o!`o@@Ϸ H`@ϲ 0w @;^@ `@-  @%  @F ^@ H (Y ( ^ {4'Z`P€뀢 @5 뀤 2O^@h/ ^ [H@o h& @= 0v@! oР' _\ (  @뀡 @' wh  @<_oSo0w @;^@ `@-  @% @ @F ^@ H Y  ^ {4'Z`P€뀢 @5 뀤 2O^@h/ ^ [H@o h& @= v@! oР' _\   @뀡 @' wh  @1`"*% Z@h5 $`ȴ 0]@̛F`%`` o] 5(`]o `@ԁ`4 H o``@ɐ H `@Ð H  `?0p @` @Q` (DDLd|@ H`h @@@/@  H/ @`"@+ @%`@!`"@`h# ΐ H `@  H )`a@]  @ H  `д @ ``H  @ H` w'/^ F #!a('!0 ] ] ]  @_s  !8a@H] ] ]   s@O  @臐@腐 ^  3'1c!P]]]  @Ѱ  _@@J ^"?3'! !X]@@%`]@: 9ah ] @2  @.]@`@;l] @ `@g'`  aH` ] ] 8h]] ]]!X' wssssߒ  w]ssss@s  @o~d*__Ϛ ww@S^v ^@`Z`@v] Z z$@  ]@k\@〢`HZ *U @ o@+ah@h%\@@R]Z  @`M`@#@:ǐhi_`@=?]@:I?` G @=5] o@;  HM@ 9\  ]@Ӓ oڰ_ @=]@:O` "G @=]o@: O@:\ @om O__@<] @:cL Gr_@<] on@: "O]o @q@go А@D]o  '@?  @?@s0/L^ ? ! !0] !( ] ] s@ a@ ]@  @S @%@# Q^ 3'1c!P]]\  @o @7  8 @] ^"?3' X7] @ڒa` @] h @] @]@@Đ`@:] @ \^ @h А@]o\p%/X 0)! !(]]]w'_  s@w+!aXwϪ!a!8]9] !`ؤaH]]wׂ ]]]_״!h]_sss]]]ssss   sssssssss'@=s/7` @n  ` *f@A$!__מ `wwww@R^ @RV ^@_X``@]  _@ Z   $_]@] 〣 H"Z *t `@`G `@@ dO@.7@+]@]?Z  S+]ah@]Z  @`L`2@3@9 hl _`]@;@8N? G;`@;x]o@9M HL@#@ \ >``] @\ ` ]  o _`@;U]@8L G @;K]o߀@8ؐ o@9 "O@8\ @m__@;5]@8I?` Gy_@;,]ov@8ѐ Od_o` @媐@娐@/& H+ @ H& H ?8`^ X`0@6 3ax][ hs@ Oap]Zor @`@ `H  @v H^`:  "+ȁ @s \ @ H? @ /h`8H /@ʴ@@@ʯ H`@ʪ @@ @z@ @u@@+@@'@!@h@ @c@@@@@"@V@@ @@O @ H`@J @@@>5 H`@9 @@@@@@@I HG`ϐ HB`ې H=`(@- H8`0@͐ H3`4 H.`@ H)`H H$`Pp H`X H``@ɯ H`d@ɪ H`h H `p H`x?0p @e` @@@ H`@ @@@` & @oZZ@ ` ?gp9 @ @ ?g`9 ZZ@ ` ?f9 @^t@@ )/ ` w] @髰 z4@ #/ ✈c'] @陰 z4@ )/ ׮T`(w] @釰 z4@ $/ Ů `x]@w  z4 ^ / ἢtt t  t ^``% ^`0*^`@Ű H )` 8@\] @k (t r \ Z "@  _v`_v`&` ^`0 _ϰ ^ / Įw v@wwwww^ )^ @X`0@)] `@h !@G] h~ @ Hw  @!?@`: @7c  "`w)!]@`@ @6@ِ hZ @6B] @G]owwwww' ' ' ' '@k-^ ) `ww 8@] w@ h,v@)a]@ @ @6#G]o@6QB!ؒ@G] o')]`$O@6@3Ba]@Go / !Xb8]@ @ b]@`H 3)5a]@ @h @F]h @^` )^`@6 X`0@)a]$H o6 )] 4@ 3%#]hpZ a@F]o_ג @!?@;: @6  `)!]  @@69oے@5B@F] o@F? )va] @ @ ^`*@^`@o"@F~]o )a]`$O@5Ba@Fm]oa /]@5=@bm H b] " oW$@@ / ht0p@6N   " pa  @> ]]@[ `H)=  t$`p^`(^``@``` `t@$`$` $`$$`($`,$`0t`8v`t`H\v`($`@t`PZZ@@`  1\^ 8 @5h t``2@6p-0ot`h / (^   ?`H ^ @ & w^ P"@) X[`2^ `@)pZ@@Z @*hR#& X@*@ X& X[`v P&  X[`@F @*[ @] >@EKh$ !Ђa]o a] `$H o@_ ^ $@ 4` o@ ^^ ^ *v o8 @^ / ; ph@4D @@4\ 8#\ H` @ ^ Z`8@@4*]@4\ Ho^ @ @*@4`@`@)0@@3Y (@3^@@*O4`o (/ Ј``]Y@J@=R\ \ 8G  ,' ( :H1 \ +p@ @[ ` 2H  )p@"@ $ ,@3\`(\ @= h$|t '''''ג@\  ?o\  b0 ]  (@h 0 ?t @=l\ o o ~P/ h@(` ``` `] '''''Zāg@<\\Uād+ , %(H 1 \ @  )p@Z H @*@3N\@3L\ ( ~) ? \ @-G!P  @Z5 "@] / /@3@_ @8`@, @C-; a x] @2   / /@2@_ @8`,@@[ @ @ڐ  \@<$,h? ϐ@Zr 3 / /@2 @_p Gܑ8` , @o@gxt@gt ot ( \@. ?n; O@Z@Ob@] / /@2O@_? @ 8`*{P@_ @c@z ?F? x@gw3w@gtw  wǔ@\b ]@@5 @ZϢb@]  / /@2K_@^ 2Oq _@1? @a]_@28[ /@2/ /@^˒oV M  Ḡ ] @ /@2@_l!o$@@gx@``` `w'''''@gww\@$@\ @-po 0(]  0@ >t@;\o "o/!X/ (`` ]Y@ā @;n\\ā 5,<$@(H \ 1  @ *0@_ `Ӑ!x1?< $(@@1`  .@X``!x@ !@(@ O ".+<  $,~t\w\w '@^\(`?H &@&`&`&`&` `?@;v\`2@ h=  h=@1!!x]@1k!b@ /]  /@1]?<@^ @8`*@Y @ @J oe?w/ ?@X?P / /@10_/@] @8` @,sP_/@^V @ P@ Ղo@fww'''''@f_/w@#\;\ @.o@@1A\@ ON'<@  *oL@@13\@ O-1@  *p@*B+o$ b0 ] (@Ɣ 0 ?t@:\o o `@X,@^ \``(& @i @2: Ϭ  H 4 wwה  "H ::7 +0r?r?:@3'44 `<@h,$`<$@ 7 4h# ' "@) Oր )`<"@8@$`<`8&h,\`0@ǐ_\`@!`$o`8t`@@<o`8o"oؠ @0@2 @ OՀ $ h  @4 Ò o$   $ 0/Sw bp ]  ? @))!]2HG\)] @ @; H"$h_` w` @$`$ `$ ` $ `$ t _t $ (t 0\]@Z \( h@0-ow`@0'@_@0#_ @}@0=hy@0obX@A] oŀ  )!]`$O )Z "`@A]o _"@!?@ H@0 @1?  |$z$@ @1? $ 8 o$@0 "@?!@0Zo )] @ $O @0B"h_@@] o~ bH /]@/@\ϒ H! ] "bP /] @/@\ H !]#oI$: 㾠^   h H?@= D`(?$`( @2O`?@`?@0`? @ "@\` _ז Q\`@   d O\` \`0 h > @/a> ht`0@/]ot` 㾠OF (@_^  H \)%_@^ ]Y) U>   '/$sswwP] ^ Y  @  z$ )&/wswww w cpw'sw!X^] ] Y @ # ]WZ  %(/ wswwww w `w'wws ^] ] Y @ # ] 㾰/^P^^^^^ ^(^0^8^@^H wowwwwwwwww@w`w`wwwwww'www_ 's("0s] Z@ ]o # ]Ă  '(/Qwswww@w`w`cww'wws _ ] ] Y @ # ]X _ tt t $(/#swߖawwww'wwwwws _`] ] Y @ # ]+ 㾰/4^P^^^^^ ^(^0^8^@^H wowwwwwwwww@w`w`wwwwwwwwww_ $s(!Ps] Z@ ]o # ] _ tt t t ((/swߖbwwwwwwwws 0_`] ] Y @ # ]V ((/ᄖ `Pswwvvvsw] ^`] Y ן@ # ]Ý _ tt t #(/hswߖcw''''sw _`] ] Y @ # ]t %'/EP a`wswww w w wwsw] ^] Y @ # ]VF   ''/swv@v`v`cPsw ^ ] ] Y  @ # ]Vk  )'/swwߊ"Psw]] ^`Y ן@ z$  '/sswwP] ^ Y  @  z$ )&/@wswww w c''sw!X^] ] Y ϟ@ # ]U;  )(/wswwww w `w'wws ^] ] Y @ # ]¢  $(/wswww@w`w`aw'wwws _ ] ] Y @ # ]x  %(/fXwswww@w`w`cwwwwwwws _ ] ] Y @ # ]L _ tt t t #%/5swߖbwwwwwwwws#`_`] ] Y @ # ]V $(/ cswwvvvsw] ^`] Y ן@ # ]  #(/hwswvvvc'sw ^] ] Y Ϛ@ # ]ְ #(/ŮԖ ch(wswvvvvwsw] ^] Y ϟ@ # ]VS  #(/4wswwww w `Hwwwws ^] ] Y @ # ] / ____@_߀ @؀ @р @%'#cx]][@ @ܔ >  @ h#Pp]@N]6`@gƀ3c@D]@+J7 c]@6//Δ]@0*y@ ?`@5]@#*ĀH*6@."@#%@1"А@] _϶"ؐ@ ]*ŀh @Fc@*]#b@]ht 5]]@o'o@#]@*ߐⰔ@]o@1c@*] ☔@]b@]@X" b@*]@ֹ]o@#]@*x@֩] @;"@*] b@֛]onPoDch 2O.%'  #Po<cX #Po7c`0/_____@_&@*΀v*v*w@?'@*t*u*@%@*̀u_*@p@*̀t% cP@]wZ  '#] ]Z@ @Β  @얐 hb X] @*f  H% &@ @ H@F&@ƀ 1#@]wZ @`v c@ּ]wZ   !#]@ֲ wZ  ) !v]@ bx@֞] wZ   @֔] wZ * @ b@։]wZ  @~]wZ   7@t]wZ  ~ 3b@j]wZ *m  "@_]wZ *\ @ b@T]wZ   b @)] H  %@ŀ "@?]wZ "@_ϐ`u_ŀ!"@1] wZ  @+`  z4~@"H_^ _tĀ 7@]wZ * h   @f otC "] @j_^`_ow@  @B ou @+ tot  @F o  @@ ot@ @ oa'@ @+ oQw  @1 oKwc@:Y]o0@)9v h)^ * ;`^I @`O))] @`O^occh @);] H cp @)2] H  @))] H  ` @) ] @ o&+')c"]]\@ @m  @4  6 /hDQ Ϥ c@@]‐@(]  @+ )#!Д @]c@@9]h @]<0 /2lc]@B Z  @`$hf ))Pސ!] @U`H+!^`Y"@(]@EYK@) "H53'@*є H!_瀤` '] `@$h7> 4`c @9] !] $O$ 4`#@@9~] o$#0]]^# @Ұ @8o!1c#8]]Zo#c(@9c] o^`4`# @9[] o`@/㈀ @  @  @ 2H  )aЊ#H]@ H 3`]@9:ho 0?0p% @A&@@_h]_?"@M\' @!\ @Ԓ Z y4ƀ ^zt@@3" ^Z "@^"ƀ^^ #^*@\ ?ޤ @@_瀦H,\[ P&@Eh"2Ht 0\ Z €o\@U "O^ ^@ o^X`H@@'oo_0/< %`^`H  ]]@_-s0/ؓ~?@ v@@ pƀ[^8 `@Q @,)] @ @#'!c P]] [ @+@7@֐hM_ @*5@v@@ @C @N @ 'h< #`]]Z@(@ <` @釐 h,"倠7#@<]@'M_o݀Z`XX@]* o_` dod@  @(A ` v@@' ?Ͱ@'0^@ov@ @F @ /d`]!@@ /Yⴈ`]A@@/P␴`h]^ X@ӳ@   h/>H`p ]]\ X@Ӡ  H `H@ ]\ X@ӕ@v@/#&vN @hL  @&#@&@' ,1*@:c 8 ^@  @&] H@X^@ @ 5'@d@&^@v@h 1#]][@ @ +ה ^@@А o '#x]]Z@+@  @ @/ɮt@ J@ @&@h- #@&l'/#&@] @5 'c]@i  @ +@&@ @4] ?h ]@\ @臒 o@/v@N @hA @& #@&/ #@4]@4 @&'@U]@4 ?@& O^@@U13'c#]] [ +@| @C h ]]Z@+o @/BXN H h?`0]^"@ ?^@& "@F  ^*?^?@/#ܞ @  0]Y   @ Y  @ / x`0]  @*#$] @%] @\]3cc  @ \*? h\@%|]@o]#o] oׂ#@S /ɮt`0ww] @^ ? \@C_  @@נ \* h8_@TP\o @'_瀢?@@%__ @ @ @@&w@T_w@%T_ow@L_@%M_@w`"@\`@T_owZ?@  @ Z o_0;%/lc]wY@      @@ZZ zT  c] ]  @֔  ] @ΐ @>@@-_>`k \ ?@Tw 1 f}4@@ ]uc"" ]\r t_> @=h@%ܒ  ?c_o ֓>`X`@J?ѓ>`Z oέ|B @#%/@c]Y@c@$Y  ?c]q@/www瀦 @w׀@ >_@_h^? ` wϸ`wǠ` ]_]@$  @; _ ) 8@ ?` @$]`@$ \*? @ @ _ _  @T_@*Π`o>@So@$Lo_@c o@$l] oܧd`@&_瀢?GŦ @_瀢 O %'_Ǣ ]?[@ے]  @X_o@$Z '_Ϙc]]  Z@}? @C @$h  @& hHoh>0 /=D##w] '@υ]] @@< @@ *_@(@^X`"#'Z "@#'J``` H (@#] H#'!c (]] Z @'?]  @ @wsww@w`w`w`w` cww'sw#_ ] ] Y @ # ] #&/x `Xwswww w w wwsw] ^] Y @ # ] %$/ؖ cHwswvvvvv v(wsw] ^] Y ϟ@ # ] $%/Į4 `ؒwswww w w w'sw] ^] Y @ # ] #%/㔖 `wswww w w w'sw] ^] Y A@ # ]  ''/swswvvvvv `wsw h^] ] Y Ϛ@ # ]R  &'/KPwswvvvvv c@wsw h^] ] Y BϚ@ # ]* p^L/ᨀ H @! @ @,?L`/@ 8o?`o,L /@@] `@!] , @!#%`]]@/ܐo/?@$`@`O@1\@O@!~\o@/° @!Β :g *@!`<`@!\@V @!eM /@ @ @0@!y@@ 'u@ hAv@1# ]]  @ر\@@1wou!'บ#]] ^ @ؠ @1gou @!J] oϒ3'-c]]\ @؊ @1Sh  ] @ opoo`L /ℊ #]'[`[@sswǐ#P^`] ]Y ǚ @ h ^`Zπ`O  /Ѯ܊ )]'[`[@sswǐ#P^`] ]Y ǚ @ h ^`Zπ`O  /4 (]'[`[@ssxwǐ#P^`] ]Y ǚ @ h ^`Zπ`O  /} #]'[`[@ssPwǐ#P^`] ]Y ǚ @ h ^`Zπ`O  /S )]'[`[@sswǐ#P^`] ]Y ǚ @ h ^`Zπ`O  /)< &]'[`[@ssPwǐ#P^`] ]Y ǚ @ h ^`Zπ`O  /┊ #]'[`[@sswǐ#P^`] ]Y ǟ@ h  ^`^π`O /֮ ` ']'[`[@#s#Ps_ 'w'w] ]X@ ϟ@ @h  _ ^`O  /8 $]'[`[@sswǐ#P^`] ]Y ǟ@ h  ^`^π`O / ` &]'[`[@"s#Ps^'ww] ]X@ ϟ@ @h  ^^`O /S `&]![`[@s'Ps^ww]X@ ]ߟ@ @h  ^^`O /(8 `$] [`[@s'Ps^ww]X@ ]ߟ@ @h  ^^`O / `&]#[`[@s'Ps^'w]X@ !]ߟ@ @h  ^^`O   '/sswwP] ^ Y  @  z$ % '/h'swߖ!cPwsw] ] ^Yϟ@  z$ '&/î'swvvvaxwsw"(^] ] Y Ϛ@ # ] %%/` bswwvvvsw] ^`] Y ן@ # ] & %/xȒbwswvvvvv v(v0v8v@"(wsw] ^] Y Ϛ@ # ] &&/M aswwvvvvv v(v0v8v@sw] ^`] Y ן@ # ]˰  )'/!lswwߊ!Psw]] ^`Y ן@ z$ ) '/'swߖ#8cPw'wsw] ] _ Y@  z$v % )/|wswߖ#a@wsw] ] ^Yϟ@ z  #'/ʮswwߊ!XPsw]] ^`Y ן@ z$ & '/'swߖ#`cPwwsw] ] ^Y @ z$ & '/(wswߖ `cPwsw] ] ^Yϟ@  z$ $'/swsw&awsw!@^] ] Y Ϛ@ # ]@° # #/O$axwswvvvvv v(v0v8v@ wsw] ^] Y Ϛ@ # ] )#/$x `8xswwvvvvv v(v0v8v@sw] ^`] Y ן@ # ]  ''/swwߊ"Psw]] ^`Y ן@ z$ ''/ܮXswwߊ"Psw]] ^`Y ן@ z$ '%/wswvvvbwsw#^] ] Y Ϛ@ # ]   '/TsswwP] ^ Y " @  z$@`@  `*H `"@ <` h <`G Hov`@ /|?@  @ ?@`耦?@  H  Ѐ @> )b)p]h Y@ a h]1o @/ҮĀ?L?Ѐ`C@ 0`H*% Z@@   d]@' @ ` $` L @ "@z hx?hv L @ @ H+  @j?+ ;he; @̐  d] @ Gހ`$hT L @ 2HN?hL @ `!d]@ Gŀ`$`; L @ 2H5?h3 @  ad]@ɒ G`$`"?L @ 2H?h?@  d@] G`$` ?L @ H?? d,d,@ /a(@m] Z    @/' #a0] @ ?8`^@^*? h ] @/  @  @ '/Hb]Y@ @Kq`?" @ '/b]Y@ @K_B!8"!8 '/خ༈b]Y@@v@#x7]@^〠]^@ -]^@+c]@^^@] #^@] c^@] \    @~hĀ \  o @o \  o @e ]    a8@J`?@eS= @@@!'40 4   {$z@ @q?% h@`]@c]`"a@ _`   ŀ ] @` @ @G\@*?Z 8]` @`ϐt@\@ @\`Z` €9 '#c]]_@ @X? @  hD@(\"v@@  \@Z 8[0  "@\@v@h1 7'Z 8^ (Ā'\`[` oׂX`(ŀo]`\`^` @o`    @^ƚ ot@3p  @ o%@uBoM @Jho /@ cx@ ]"6 @m "H1 ƀ  h+ ϲ#]@m1#]@ @T 2H h ϐ#]@X@] "  @@ "H o '/؈b]Y@x ƀn"q # `?>`* @&T T @L@L\@\ t@\ t`\ t`\ t`\ (t` \ 0t`(t @.] ~4HFi @!i#"H"ƀ@C9 k @=9 ick )0@ # `"OŐh29 j Oꀤo9 k )0@ #`Oۀ e @5o@V oð^[@G@  o a8 @] h@Io '/Ἀb]Y@k  "q #`?>`*p@ ƀW @% E @=@.)] ~4HFi`@!i#"H"ƀ @C9 j`@ 9 kj )0@ " `"OԐh29 lOꀥ o9 j` +0  "@ Oۀ` e @ @$7`o@ܐ oð^[@G@ڑ o !8 @ڞ] h@I$o  '/Ԉb]Y@  v`?ŀnv#"q6`,0@ \@$Җ J`@BZ vZ vr @-] ~4HFi @!i#W" @R9 j @ 9 ick` )0@#@ "OϐhA9 j`Oꀥ o9 k )0# Oۀ` e @@7`o@Z oð_ Y G@ o% 8 ]@h'c!@]  ]Z@C  o @Ho  '/ ᐈb]Y@r   vŀp`?#"q@ *\  @$h H @@Z vr @,] ~4HFi`@!i#"H" @C9 j`@ 9 icj )0@ " "Oh29 l`Oꀥ o9 j +p  " Oۀ` e @@7`o@ʐ oð^[@G@ o !8 @ٌ] h@Ho  '/㌈b]Y@u ƀk"q #`?>`*@  @$ O @GZ t`\ t`\ t`\ t` \ (t`(@,Y] ~4HFi@!i#"H"ƀ`"@C9 j @ 9 ick` )0@ #@ "Oʐh29 j`Oꀥ`o9 k` )0@#@ Oۀ` e @@7`o@F oð^[@G@ o a8 @] h@Go@ /|aH] @͒ @P]  @Ē @xX ] @ @l7` ]@ @^ah ]@ @Pap ] @ @B5x ]@ @47န ]@ @&! ] @ @5 ]@| @ 7ᘔ ]@s @]  @j @3a ]@a @ߐ ! ]@X @ѐ7Ḕ ] @O @ ] @F @ #x ]@= @Ȕ ] @4 @7Д ] @+ @ aؔ ]@" @{ ] @ @ma ] @ @^7 ]@ @Pa ]@ @B]  @ @33b ]@ @%7〔 ]@ @]  @ڒ @ 5 ]@ђ @7 ]@Ȓ @"  ] @ @( ] @ @А "0 ]@ @78 ] @ @@ ] @ @3bH ]@ @P ] @ @7X ] @ @z c ]@w @lb` ]@n @]h]  @e @N7p ]@\ @? "x ]@S @0b ] @J @!7∔ ]@A @ " ]@8 H' c?]Y@̊ ' c o]'  ,o] '  o] 1' # +o]' # *o]' # )o] 3' (coղ ' #o '  'o] ' #oŴ &5' ]o %' o ' co $ ' c]o #' #o "' co !3' Ҋco ' co ' o 1' #o '  o] ' #o 1' #o 5' ]o| ' o~ ' #oq 5' ]ol ' #ot ' #oa 3'c] o\ ' #od ' coY 1' #]oL ' co| ' coI  ' co< ' o ' oF ' #oG 1' #oH ' o1 ' #o8 3'oE ' #o< ' #o @ /nb] @3 @b ]@) @@" ] @ @7Ⱄ ]@ @ " ]@  @t`@k" ] @ @\7␔ ]@ @N "Ȕ ]@ @B]  @ @4ؔ ] @ܒ @%7 ]@Ӓ @3b ] @ʒ @ b ] @ @!" ]@ @7 ]@ @]  @ @5 ]@ @ # ]@ @7  ]@ @c( ] @ @ c0 ]@y @3c8 ] @p @y7@ ] @g @j5H ]@^ @[cP ]@U @M#X ] @L @?7` ] @C @0 b` ]@: @!h ]@1 @p]  @( H'  F]Y@z' # Eo] ' # )o] 5' ]o D' o C3' ِco  ' c Bo]' c Ao] ' oѴ ' #oԴ @5' ]oǴ ?'  >o] ' co =!' #o ' c <o] 3' ;co 1' # :o]' o 9' o۴ 8 ' #o 7!' #]o 6' #o 53'oܴ 41' #o 3'  2o~] ' ]ow .3'oǴ 11' #o 0' o /' ol -@/@>@ _`( '\ @ 5]@@ @t @]  @AC\ H* @@ht H@Ao#]]Z@ m@ɨ @ow`( dc]$ t 0 @/@>@ _`($ '\ @ 5]@@N @t @]  @A\ H   !!@ @@:t Hh @Ao#]]Z@ n@b @ow`( $c ]$ t 0 @/u>`\ c@`@ ]  @#h  \ ]`@  "H @'/|ch]@LA )b8]@L` @@ H H@+hH o@^@v@^X`@@^Y @@'#  `~~/x   ? @ ]] @[@Ӭ_`[`(@ _`Z0€@>^v@  d~d/̀2HƀH!@ @~_` @ ^@`@]  Z   1'#] ][  @Ƞ  @i@= @H HD` `H?1'#] ][ @ȇ _`  @N h/@H+_`( @( ' #`]]  @p^@hw`(@R"` `H@!^h^ @w^@Z @?cv@/@@ @ >y `]?w`0@?>_`Hrow`H^?)!]   @;] 2H^"H  `@ @!]@@!]^*? oҷ>@/ۮ@  @ ̀(>< ] ow`0^?' #`] @{ ` \*? o倦]@]  @ұo)  /,@)@> ` @ ]w`0 '`_`@ @>Րow`@@?o'`]  ][ @ǵ  _` @} ^٤#-'1`   ww_`@" _`@` @_ @O^ ? _`@"@L`H\@^@`8tt@@?\  ">@Ԋ> @Ԝ] \ @n]_`H @]` @`_]s @* oצ_\  @V] o_`H*?t` ` "OtoȤ*?Ƥo_`@/Ȁ@&@ >l hl ψ` @]_`H @=w`H'`8`('`<]ow`0@?'o ^?ݢ']  08@ /ϒ -@ǐ @@] "@ ^t@@?vĀ\@ ?>@> @h@Oπ "H ]@Oϒ  @ ]]  @  @њoפ]o]0/̀@^ @ > h"!w`8^@N  2@-^!'#H]  ] [@Ơ   @g_` @D '`8^@@`'`<) (]w`0ӗ>@ӗ> @өhc@I  "O!'@4N  2@\N `-2O!'\@*J` O\J -O!'o^?+' c ] `P X  @0_瀡`I "H`8^t@@>mv]  @B]@ @  \@ ?o @`< $O^t@@>Rv  ]@']@G`8G`<  @o@/ 7@@!@>D_`(€ %'9  p]$ t 0@ h0t@h]  ] [@ @h9ow`(^ @  `\@"< \`@!\`ht@>o '#``]]Z@  @԰  @Н @/3@@"@_`(>€ ' ` p ] '`w`0@Ӑ v^ @͐ ^^ #@ @!x^ ov@=och]  ] [@Ŝ @ow`( '#`x]]Z@? @ō  @V@> @ ,h ` &'```'`@> @ h ` '```'`@> @ ih ` c'```'`@> @ h ` '```'`@  ^ @ ߒ @^*?^  0^ p2 @7\?\0p%\@&@ ̀#^ @ v @_Ā\@\" \Z " \ @ @wq @$B_@_ߘaP] @*%\a "@$3@@ޔ@; %_߈`]@ _\a(  @͔@:h_ߟo3aX@9]o߲@<o@ %/㬈`]@0/ٮX@;آ  |d~$@HF %\ h]Y@@6ht h(c] ^\ X"`\ `@\ `\ P @.@t `@@  ht Pt X@Ih @ o?\ P?@ 8 O@7\ h_!@^@o@\ ` ?\ `ot `P '/(bw]Y@_) w7 ah_7@a] Z r _7!p@Y]  Z   _7`@N] "_!(Z wr   @7_7@@ ` "@\@^@^@ ?\ _7!@:8;!@ax]] )w'wŁlww@8̐ww''_! Yw'X] w/_/@?z!@_'wwwo]@C@:Z \`t @t`_@ |  _@: @~_7[w73a8-w 'aXacw@etut_7@?At _7Y @?<`t0\@Ā`@Vh$\@\` $_!@`h@\ @?$\`t`"Ā]@ t(\@8tH]\0@ 6  2H\0\0I @ \0]@ *  @ __7\@ w7@!@9_h@9G\  ''Z"\pZ @c\p"\@@ @W\@"@\0\0o*  @ @> L  @4 * ;` @:* :`'"@3`* 9 `@$`'@;``\"@"`+` @ * 8``'@ @ O* + @@ @8@ @ *  Oҟ* @ o\0L@ O @o* o @`L@ O @oĕ* o\@@  @>Q \@ `_@ ] w@?@ *?\p_?"?\p@>9 tp_r\p_?q`\\@>i\poxt) @ $8@ L@ 2O`L@-@ @o`* 8`@ :` @ @L@ -@* `o @* @o?$8@ jo;$<_ Y@ @]@ (ot(@>4]t`oth@Jot@oŶ!@] /'o_/ '#a] ]] @ owv@t@uott@o~[w@oWw@9o,0w^ H@  ^ @.^*?h_@^ o^_  x@=Ğ@ / a0]w@ 5 @=ѐ v@@%'9 )37+`"w wߴ` `wwϬa!! @  *@] @  @ .@` he@] @o @] @o @] @o @] @_oް @] @_oְ @] @oΰ @@] @_oǰ @] @o_ϐ@] @o$@] @o(@] O@] Ho]@^  O@a _ot: 0 '/Үlb]Y@ƀ  3 +^ @@Ӥ9t@tt`t`^ @=t` @=^ 0 t`0^ `@= $`^ ht``t`h@^ (t`(@6^ H 8 ^[ G@̐ o @o_@?@o_@O 4Z  Z( ^Z`(  " @ ' @I >Mv9'5#(] ?]@\@ @ƣ oҠ  #' ^[(@ o'@`eB@} owgwowwww] __ @_ `@`Ooo' o @:7oOи  @U h 30  2 o€?@4o@'/#w]   20 Y@'S ł.wG@4B(Z @?^" \ 8_`@22`@v\ 8€)_Wssssi -)]$@  @L3b(@]h _W @7#h @]@_Wh  o] @J  +#w/w_ '#@^"@))w/w!Ъ b80_/"H_'w] ~dw?w7w'wwS H ]*AwAxߤ@ÔD`@$`2@@@ _@] )`Dk#;`k ,@#`@`@@`"q+5p 2`b@@z@ @8^ wG0p @Π ?`@L` @ |ty4@H"\`@ \`[ € "?S@ oS@Ƭ"X@y] o\`"? ;`jcl )0$@"@`@o @Ə"h@\] o{ `O@ƃ"`@P]o@  }t|t2@s\``HW`^ P] _ !@] \v] q  # @/]@\ "x@$]h  S @_] %)_@^_^@E @%)]$H bp@] h '7X]] ?^@@, @@^v_h'@@o] "@^@ o ] _ "] [`vo] @o] X` o bP]@ o/?*pk @+p 2O++p" *0@ *#`2O+o`$ ,@ +# 2O퀡 o`"] @x] @7] ] ] _wG]@ `$O?_] _G@fo?\`Y @` "@":`*>*>D\`Z`_G__' ]@v o_/ ]@o o@_?@o_G@MD  Z  [(@ o~@^#@^!BB _7] s_G@F o_?o] wwwww]ߒ  `@`Oo@o'S @ o0p   o^oZ @@2oҬp/߮ؒ w@v  'b 10 ]'kw Z'c L @2["ĀZ @Z @‚>??"@) 7 wW@C@_@%#@D]@h3@@_Āw #@] c ]@+)a#w wG  ]b_Gb" ~dwOw?w7w/w'wc`H] AȒ __W@V`@8`2@j@Ő _7]@s (`Fk#;`j *p@ @"`@`@@`"q30 2`L@IĀ @6-@1׀ 60 @ ?`@7`  ~xt H""^@`@^* Z 8^[ "? @ o [(@o^@t_'@B] o^? @ Oc@g_@5]o   |~H ^*Z 8^] ƀ<`HZ`\ _r@ \ _r \ _v\ _u \ (_w \ 0_v`(\ 8_s 0\ @_s8\ H_q`@\ P_s`H\ X_r`P\ `_r Xt t t t t (t 0t 8t @t Ht Pt Xt `7#]@Ȓ!#@!#_W @?]9)!]@ G ^ "@]h$5)]$H-_o"@\ @ oհ_q@ \ _s`\ (_r`\ 0_r \ 8_v \ @_u (\ H_w 0\ P_v`8\ X_s @\ `_sH\ h_q`P\ p_s`Xt t t (t 0t 8t @t Ht Pt Xt `t hot p]`(oe^_/]@Z o?*k @+p 2O+p!@ *0 *#`Oo`" *p@ )p# 2O퀡 o`"\ @3\ @5 \ \ _G@8]@`O _?]@#o?^Z` "@_":`*>*>F^[`oGo@! o @o_W@ o?@o@K 4Z  [(@ ^Z( "k @k'gg @D >_v5'1#(] ?]@0] @ oİ ` k'k^Y (@ #o'g@[B@Ґ o x@r_O] __W _O `@`Ooo'c o ?Oظ @_@#@!] @ @ h 2   o?@0<o㾠/w8@0v@v`v`v`v` v`(v`0v`8v`@v`Hv`Pv`XZ H"@o]  A@S)!]@`4@ 6 s  h b@T] o6 @4 - ] d@ ?@t'\;cp]$@Akf@@ x]@`Hakch] @M'chx]] ; %@@ %1!+Zc]@ A) "]@.\@@t<`)0`@ ZA@Z@-]@O<`"c] ccp]]]]]6 sh(\+"oc+p @] r*@rrrr r(r0or8!]cp"Zc] ]o]ok;,cp]o+@0 ) waw ''/0w@" ]_   b^ ^ ^ @I^` !@@@^H ^"@]^ "]]^ @^ @- o^ @ZB@ h#bȘ] ] @&^ ŀf`]*Ār\ -^ @]" \Z " \?"`\@w \*ZZ 8\ _ ( "뀢 H '뀧` @'HG'`' #\ Z(@_?`Y  ^@CJt\ Z( #@\*@$\ \ \ @)]  @ )^ "^]^ @*^ 7'5(]]^ @? @H hZ`(  _ hp@o` X`(ƀot] ( o-p#  Ϧ`/ @ ĀU`@@B]@ݤ D kcj )0" @ ``@@poݒĀ>=``H`@@  _# @]h+=`_?@ @@@ߐ@@ @ @Ғ@[o#^ Y @G@ o@  ~$~d@H1&@`"@"^ @`@`H% @|`h!^ v`^ hv``H^ v`v`^ `@2 (t@f@_v`^ v`^ v`v` ^ ?`   z$zd@HN"@`"@-Z @`@`HB `@A@Z r`Z h9r``H6Z r`Z r`Z r`Z r` Z (r`(Z 0r`0Z 8r`8Z @r`@Z Hr`HZ Pr`PZ Xr`XZ `hr``r`Z r`Z r`Z r` Z (r`(Z 0r`0Z 8r`8Z @r`@Z Hr`HZ Pr`PZ Xr`XZ `r``Z hr`hZ pr`p  ztz4@H Zr@Z r`Z r`Z r`r` 0 ) /!Ѐ @>`] @ @"h @ ]h @& @@& `?@/H_@- Af@$8$(@2 t@ t@t0@t@$HO @@ N @5 @#\@*@ \0# ] @ @?# @6 @ ?tP   dt H? `(p@1_\P v_@  td O? h @@t oʡz$@;toz$@z tX@ ;    @d`*` O@v/4w`H  @M h  6` @@ @_Y @@@`2 &@ @ `w6`@8@[@l1)!]`4@a5 @j@_ @: @_Z "u Z "r % @] @hh @Ɛ_^0@^ H] _[ 0J@ .`?`?"HR @[ _@[` _#@] t_or   @_ @^ "Ā8@h4@ov3#`]@2@_ow@ ]o@g>`@e@"O'c#] ] Z@ @? @ o_ o’  '/5b]Y@@ l  a=@u @C @$ H''c#]]^@ @?F  @ hwc#]  ] ^@? @q hh^ 0@ c\`` ^@^@ @!#v@hU ]@@&^@ov@hK ^ 0\ X) @# `v@/\ X+0 @@^@ 2@@ ^@v@_[8@@3B @h&_\`8h  @Xo^ 0@ Z  @@_o\`@ o@+om@/ᜒ ` @ע  * @It?t 2!$ (t $ 8@^ t @c$ H^ (@I]t X@^  t 0c@]t ^ 0"t N@t h v@@}ot @ 0/\ฐ @ `X@k^ t@@h^ t0@e^ t@b^  (t $H`@/tP^ @?t$8tt$(tX^ H"v@ P`@2`5 6_[`X[`tX`8s`Xt$8_ @##v@h( `@]@\_ov@o$80`@\ tP H:O^ @<^ 0(p\PY@@/.t@H*O<o^ @ @W @/ @*@W `  @E ?^1p!r r r" (@^  t 0$ 8t Xt t `@]$ Ht P`x @I @? \``| "@4@o: "-Z@t @\` "@\ @t` $`|  H> <`^ )0`@AB@"  @Z<\ P+0/r  @ O<`h)v@@o#o] @ ot @ 2O\`@#o@#@$?  H ??o$`x0`@*pot Pv@$ H 0/''@> ' #c   ^@h. @5`@@7 "H# h!?]]@^ )! \ ]a@#@ ] `]]G@@u^@ov@Ј  d~/Ѐ@hfww@w`w`w`w` w`(wwwwwwwwww'9` `@6>@ϔ0'@"wfw `߀@ ~$@@x@@mo?_ h!@h` @ @ @ "O_''%]][@ @a  @) o @ w@ @ @(@> @uw _@ǒ@Ht@o@Cow@@_@p_@w@h v  @Y @@[> @@w?_dg@ǒ@t@o@ov< @/ޮ  @< '#`]]Z@ @ F@@^&@Ђ  ~~d/@@SƀR wvvvvv v(wwwwwwwwww'@@^ wߢ`@@ @@?_ h"@8h` @ @ "O_'`]  Z] @  @O o @5 v^I`@ w _ @ \J`2Owh @@pt@o@kov@_@^v0/3w''ߖf ' #c  ! ]]@3^ )! \ ]a@Y#@S] `]]G@J?@^@v@@`/ @`8H ̕1`!(*% Z@h&` h$  @3̃3 aP(p%Z  t$ `H" ̙1`x+0% Z@ 3` ]@Բ   'tc ] ]\  @@ $ `H ̙1`+0% ^@@5']]\  @ o  $ `H! ̃1`aȳ(p%[\ @& ^ o @$^ o  '3#c]]\ oٔ  $ `H8̟1`a+%[ o '1#] ] Z@ o @^  ?@^ +? ^ @`5 'tc0]  Z]  o ^ `(@] H^ @I t '`  o'`  o'  'o3'`(_`0 )@``@w`0'` o)'`@ os'` `4h ' $`@8`h'`@@*? _  @w w`0o,@@_ ow @2Ow`o^@ @@@@@@@@@@@@@@@@@@@@@4@@@@@@@@@@@@@@@@@@@@@ ,@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@h@ '/ᄈb]Y@Āª   ~$~d@@?^@ʐ\p@ Z`  ztz4 @\@  |t_` {t @_@*_` ŀO] [ @Ò Hp_`P ] *@bX` ]*?] @' @@@= :@j]@   @'`@b O`?]@ `7 \@$ @@r\@ @& , @ ;@@ @] @R?@ HM?`@ -(]1#@] H? h=?@@o\@@oɪ@@ oɠ@@U 2O]?] ` `G]o]@v 2Ow_@tpw _`PY sX` pon @5 2OZ\o\p@$o>Z?w vvvvv v(wwwwwwwwww''{'w9 `@8>@o"3_@Ðwfwߠw{`@!@?@?'@^vvvvv ov(o_ h> @> @^^@   L@` @` f`>?`,?L@hv@ @ooO `? v4v@ &$/'swvvvvv `pwsw#^] ] Y eϚ@ # ]@5 ()/Үt a'sww@w`w`w`wwwsw] _ ] Y f@ # ]@: %'/Ж a0wswvvvvv v(v0v8'sw] ^] Y gϟ@ # ]@3 # '/} awswvvvvv v(v0v8v@"'sw] ^] Y hϚ@ # ]@$  #(/Qpwswvvvb'sw ^] ] Y iϚ@ # ]@  $#/+wswvvvvv aHwsw!^] ] Y xϚ@ # ]@ F (#/< cswwvvvvv sw] ^`] Y yן@ # ]@   /ޮwϒ  xwww@ _%%!s_^s] ]Y zϐ@ # ]@հ  ')/ cPpswv@v`v`v`sw] ^ ] Y { @ # ]@  #(/h cwswvvvvv v(wsw] ^] Y |ϟ@ # ]@ ( $/easwwvvvvv v("sw] ^`] Y }ך@ # ]@  /?(wϒ  xwww@m_)%#Hs_^s] ]Y ~ϐ@ # ]@  &@ ' %/xswߖ#Pcsw] ^ ] Y @ z @Z  @z xT   "  @@C^ ( <@^ @t`@@^ Ht`H^ ` /^ p @ ^ h 8 cҞ"ub$ Gc$ $ $ 1-CD5D c؂b$ $ $ $ $ @&$! '$ bt!@]t!Hq@@ '/pb]Y@@ @Ȑ  '#X]r@\` @h @ht @@ ho@ '/Ԉb]Y@#\   ~$|d@@ \ p*@X` ^ @ﴐ "@t p^*?^ h h @塚 2O\ h\ p@ 3oݠ@ '/ʮb]Y@&(?"`^N ` @ K@)`H @ ) ` @@+   )``2OK@^ ?…?h@o@ '/<b]Y@ @@ ,  @   H   2H ho @N/p⨂?`.H ×0`X*% Z@ ]@- H' !6] Y@_7]@ H' !8o] 5]@ H' #!7o] `] @ H' c!9o] ] @ @3'c] oǴ!=7]@ @' #o״!>] @ؒ H ' c!?o]  @]@ʒ H' #o!H7H] @ @' !Ao]  P]@ @' o!B3`X]@ @ ' #o!C7`] @ @' !Doi] `h] @ HW' co!E5p]@z HJ3'!Fcol `x]@m H=' oٴ!G3`]@` @ 1'#]o4!:7]@R @' co!;] @E H' #!<o]`8] @7 H5' ]o !@$\p@ "q)0\ Y @Bjcj@9`)pk #)0+p *# @"@ @"O\  @ '/,b ]Y@@ @'o@ '/b]Y@*" @" @^ /ٮ㤒   @"r@ː &t bv ]@]y@^ @<v Z*@p`@2@0@]+@&@: j@I@"@@ @휠"w$  ; w@I@n@I  @֘߀?@ @ @\vo @,?Oܐ 0 /t`ؒ]w@ 4@_>(p(p^ J`@O>h_@F@o0 /Pဈ`ؒ]@w@԰F@@^@ԪF`@^ @Ԥ^`@^ @Ԟ^`@^ ^ F`@^ (F`@^ 0F` @^ 8F`$@^ @F`(@^ HF`,@^ PF`0@^ XF`4@^ `F`8@^ hF`<@^ pF`@@^ xF`D@_@  > /` H(ph]]Y@@?/ؐ&@쮒 /  .@쨐 1@l @&  +* & $@ v@@2^@h4)@%@  v@@0h+ '#`&]Z@] @? @W @?O&5 @$] O' #`]]\ ?@s o /d`o]@ߐ@ /wao]@͐@Ғ@}@@}@@ @~y` H@~ 0w @5^@  0@'   뀢@8  H^@^@^ |4'[P@ @* 뀢 2O^@h$ ^ Z`H@o @v@ oֈ' _`Y@뀡 @' wh @_o@ $/@`] X@{Dz` H 0w @5^@  8@'  ߐ 뀢@8  H^@^@^ |4'[P@ @* 뀢 2O^@h$ ^ Z`H@o @Bv@ oֈ' _`Y@뀡 @' wh @#_o@/⼐@}3 H$@`"@`@`H@g``H`@| H)``]@{P 0@gz H`@m` G) @/l@} H@`"@`@`H@g[``H &``]@{' 8@gQ` G& @@| H@`"@ `@`H@g:``H `ځ@g3 G` @@|ǒ H@`"@ `@`H@g``H `@g G` @@| H `@ ``@  `@ h @f`2H @}՞@0w @5^@  `@' ^@@I 뀢@8  H^@^@^ |4'[P@ @* 뀡 2O^@h$ ^ Z`H@o @Gv@ ?؂ h' _@Y@뀡 @' wh @(_o ?`0p @}@@?/⬒6 @}t` H@|@` H@|9`6 `H @}^ X$` H`]@zG @@|  H@`"@`@ `@`HƓ`@f\``H `h@fU G` @/Mሐ@{ H0@`"@`@ `@`H&`@f8``H'`# @z] H(`cp] @y (@f% H '`c]@y ` G( @?6 @|` H@{` H @{6 H`@| @/4@}'`c`H  0]@y X` $ H ]@y @@{x H@`"@`@ `@`H`@eʓ``H `ց@eÐ G` @/@@{T H0@`"@`@ `@`H&`@e``H'`# @yq] H$``] @yi @e H '`c]@y^ ` G$ @@{ H@`"@ `@`H@es``H `@{ @el G` @@} H`@eT @/YḒ@})`` 0`H@x]`$ X `H ] X@y` H@y  @ '/3 c] 0@x۲` H@zÁ @ '/ Ԉc] 0@xȲ` H@z @ '/ c] 0@x` H@z @?/<0p @{״ `` $ H!]@x @ '/c]@x @?/ܮĕ0p @{ `` $ H!]@x @?/Ȯt0p @{ `` $ H!]@x @ '/$c]@x @?/0p @{ `` $ H!]@xp @/Ⱂ`@| H:`@| H5?`@{j6 H.` @{d6 H(`(@zK H#`0@{Y6 H`8@zv H`@@{N6 H $`Pb0`H]6 @d}  H$`X ]@x, X @@^ @@^ ^v`^ v`^ v`^ v` ^ (@v`(v@@ @ 0@ Y@r Y`r Y`r Y`r Y` r (r@@^@礁@/^@@ `@A !] ]@@ 8@Q " r ^r ^ r ^ r ^ r (^ hr 0r r r (r 0r r@`^@v@@ؓ0w @^ ؐ t^ ?_@ ^@Y\ @O ?@@`^@ `@   @ʐ @^ ?  0w^@@"`\@ @ ^`z@Y  z@2H@ "H^@^`@0^@ `@\_t0  $~$/8H']]Z@ @P  @ h%w^ >[`(7)]@`@ F! ^ @]h\ [ _ ?@_ 0  $~$/4Hww@wa0\ "ƀ \]@f\@*t ^ \*?\ _*@^ @^ >Z ( g^ Z _ߟ@_@_h\>Z(ߠ@"^ @_hM[ _ߔ @@_ ?_@ _  _ `_ @c_h0 @Ðo@\` Z @\ \ @ |4O @ `G_\@wt@o_@?_ @O h \ @@\ ot 0 /"a( @]?0p% @ @w_ \ "@\X` € \*?\ _h_@o\@^`(^ Y @"qBkc+0k@ )pH"@(p@)0#@ H^ Z@@/=`"@v^*Z v @Β @. 8at ] @ t v6` @ 0t (>`>@@ @k^ ?h@do@`?@^hv @ '#a]]Z@  @  @@/T^  ƀ '#a]]Z@  @װ  @@^8^ "@^(@'X@ ?^(@ v(@7^8@^8@\@/^ ƀP 'n^@ Y^@@] Z    @[@^8^ @`1^`(@*`\`@ ``@ "@^8^^ @A^@ ^r* /v@h^(@@$7@^8h@ oͲ @o\`^8@ݰ oIJ #a]]Z@  @^  @'@^ /@\ @c_`8_` Ā\@``@j @ \\  \*\@_`8hI @_`(@^@v@]\@ /t ` ` t@* \9` /7 l .p@$;@䑐@䗐@@֐ @ P@#@x_`8h@ G@B@ o '#a]]Z@ @  @ @/H^ iɗ^@ s^@@] Z    @@_ 8^@8`J@ _ (@^( @yd 4,#`$@\ 0_ 8@&   '#a]]^ @ ^(\ 0@p\ 0@``@B\ @T^@ t \ 0v(_ (@R@_ 8h(^( , /t 0@-o v( ov(_ 8@ o _ 8@ o '#a]]Z@  @m  @6^   |~/$8@@ '#]]Z@ @R  @ hI\8@^ @3v`@\(",^@Z Z wZ wZ wZ (wZ 0Āwƀ-@wĀ ` @ @^ ? \@ /_u- /^@ Ғ`@\8h #_ov@^ ot`@ow ^   |$~/਀@@ '#]]Z@ @  @ hv'\ 8@  !w] @ Z *Y 'ۨ > t|x @  @D4_*@p@ ۑdH^@€4"@\ @+\ 8h \  ~4|x2@^ \*\o@ "H ^ @t,'t>^  ~4|x 2O^ o\@ov@\ (o_.0Y@ @^  H   /@t,'t> |x@ O4O_߀2H? @ 54_.0)p]]u_oq@s52 5jK@" o$@Tov u  \ (@瀥@`]@ j ^@@`wwX@@2ow_o]to[^@+a]@C?S\ (@oM@/߮$^ @- @)^`8`0`$@^`8 H0&`0^` ƀ-?1p!^`^*^h#^`8@oz@k  'a8]  Z] @?@ '#a]]Z@  @ o ^`8@N@/^ @ @^`8`0"H$^`8&`0^` ƀ?2!^`^*^h^`8@^oz '#a]]Z@  @  @v^`8@/e<  @?@ t` @H`  $`p.@`$`x!@`H$`taH)]?h᠘] t` @Z*€Ð  4`H @3'1c!P]]\@  @e @- h @`p\`$`4$`0$`8t`@@/t`H@/t`P@`p"H"qB+0i@ @ich-p&@--0!@`H \`?` r? a\\ @@]" ^ (Z " ^ (^ @E @g@^ (@ ^*^-`]@v^@'t`@^t`(]\@Xt`@ ?\@o`@@ ې@⚒?@ 5'\@*`]@ \@ot@1!X]]^ ot?@*?^ ("t`u   t*`\`:  /3`]k  /)0@@#@;9 @A@: \`@o @gh@H o @^ @^  @  ^ @4@2o@^  ^ @Z ^*?^ @ /Cⴉ9`N`@`O9` `a`]10 )@`    )@o`)@ 0 0/$w瀡 @` 4 @'^`@ apL`/ / @[ /\@*L`/@ ^`?@Lxa]]^` /@\0\0!@\!?@&@_: _ \  @8 ?@\*?\ @ \0@N<`@_@2 v`ht @B@Ő @?<`hj@B@ @5<`_\ @ Ð`\*?\ @_hU@B@ hN ` ` ,`/*:`^`2 ]k \0(p@#@X9`@^\0\0U`\0@f\8]@\8 @ c ?ʒ\@t@@ \Ht@\H  \0@\8"?w\@o_@otHc!P] ] Z@ @  @s h? 1p!v`~ /^ ?@ q^   @^ ?@"@@m @@Chy't@#t `@ 5r@;+v@~u!\>ah@>s@Z>3ax@~v)]>a@  t ?`Z@3]\ /^@߲@ ]ߦ->X@^@]]\ /\H@ߞ!\H@ !3<5` @ "Hϒ>~߂3p@@~v\@-~!r3!@~Y@"t@p@# ]s /\ /@_\H\H`@ ɠ@?G<  !G倧`@_ @ !"Oސ\@\Hoِ?0@j O\H@P\P ]@l\P@  ~4X@zd@\Xf@ 0s"\ 2@\\ t H \  (`/X@*(`/@\ ot @\Ho?瀦 OZ ?ဦ! ?0@  "O߀ o׀@_otXZ@@U]? @@o \H~߂X@@ ]o \ot@[ @)`` O )7?@@|G@hB\@y  /' /s]\@޴\H@ !\H@?G  @G ~@\H?J `2O\H@޵\P\H\P$ * \H@.\PoՒ@!?@ \H@ ː@ >o`@B@ @/Ʈ X@c a ] #@_  8 Pt  H   @U ( 0t`  @M t @^ @f 8\ @b   @H4`^ *p`Z@g\@U\ @c @ O4`@M^ @Z^` ^`^`^@^`wwwwwϒ@S  2 H)p^ [ @    @?@:H v0`^ )0Z\ vh% h# 4 ^ )0Z@L\@ @   *O4 o?"H?^  4 .p3Z +0r^ p@ o @ v@   @ 4 ^ )pZ``"H  X`Z@ `@ ^t@   O4 h@ Sov@0 8  /w@ @'^ 3``*0[`@ O'^`a@E] ^ @ho_ 8Y r@ 0ww/خ^ @ _ߋ2Z )p["(__ !Z`@]QZ N @L ` @'?@@'0`^`+[@w_ߒ^`@h9 @F w@`v _ߖ   @? v ^@@lo_߱4 ^`.0[ @݊^ @  `*O4 ô?"H?^` 4 (p2 Z )pr ^`q o`/kT^` 8ᰢ @] ^`(^`0^@^`^`^`^` wwwwwwwϒ@3  @h2    @ \ 2 *pY@`X  *O2 Ā[\X ĀV ` @)?@HO0`\`,0 Z   @  ^ 2 *pY@ `  *O2 `H:@^@^ @\@@@h/@<^ o 6 \`,0Z@\ @  ` O6 oʂ?"H?\` 6 (p3Y@)0q@ \`r@o`@\ o@^ o /ܮ t x@ܖ^ /h >  N@hP^ @o@ݰ "H@  H/= @Q^ @)?  ah;<-<`^  /]@c`@А@ݏ= `H  @ @/ @` O<`v h @ܚBo  O`  o <  @2O o!%/x?Ḣ ]] / /@!@?@K@! H@ @7 /@ܕ#@aȤ ] z] / /s@@ܑ @ '#] ]? @p\@83aؒ \]@g?@0h@ )o '@ %@ /@Z z@֐ 08hC *@ v@v`v`v`+ `@( ?Њ? + ;` ` >  H К? `H`@" +`+ ?Љ9`? @` H *  + `Oܖh + ?>  `@O?`O?ɰ Z Z`@ʞ@ZZ@ `@+@@ 'c/a    Z  @\ 8.\ ( @ Y`Y`vY`vY` vY`(v Y`0v(@.'h v@h]]@[@\ 8@:@^   ~~d/㬀@@ '#]]Z@  @  @w@^8^  Y Y ?f v@ @^8@ 'c/Wa   Z  ƀ ]]@[@P^8@䖰 &4@^8@ 'c/9⌊a   Z  ƀ ]]@h[@2^8@x 0^8`@&00w/ `( @)''"]ZZ x" ^ _ @q` 2H^ ?'h!3`@F ^ 6`)pZ & (h?o'@ oZ x1 ^ *0Z `@P` "Ho'@/@7@ǐ" ]Z@bx]@ 8 `? d@H! H !@% @: h$@@&@ /Ѯhb ]q@@/Ǯ@;`"@v^*Z v @x 8, 0bt ] @t v 6`0 >`>@@ @]^ ?h@Vo@R?@^hv @\ '#b(]]Z@  @  @c@/x^ @ @^`0`("H$^`0&`(^` ƀ?2!^P`^*^Ph^`0@oz '#b0]]Z@ ے @j  @3^`0@װ@/D4^ @- @m^`0`(`$@^`0 H0&`(^` ƀ-?1p!^P`^*^Ph#^`0@oz@㯰  'b8]  Z] @1 @ '#b(]]Z@  @$ o ^`0@㒰@/ ^  ƀ '#b(]]Z@  @   @ӕ@^0^ "@ ^0X@@`  ?^0@l @^0@ّ@/ծx^ ƀk '^@ t^@@@] Z    @@^0^ @&`L^`(@E`\`@ ``@ "@7^0^^ @v^@ΐ^rv\`@# @  z\`@ "@  ^0@ @roB@\`@ &G^0@\`@ 2O^0 @U@^0h @o@ o @,o\`^0@ o #b(]]Z@  @x  @A@/Ux^ Ā+ '@~\0\ "\0^ @ `@ @ \\  ^*?^ \0h @^@v@^tv@͐@h\0#b(]]Z@  @8  @@⦰@/p^ n^@ x^@@@<] Z    @΁@*_ 0^@d`OZ " _ 0` @5 @ \*? _ 0@r o "?_ 0^( @yd 4,#`$@\ 0_ 0@a  ' #bH]]\@ @ ^(\ 0@\ 0@``@}\ @^@t \ 0v(@C_ 0h!^(t 0@Po v( ov(_ 0@2 o '#b(]]Z@  @  @{@/`^ @ '@\`0\` "\`0\ "ƀ \`@ƒ "@^^ \*?\ \`0@ @B #b(]]Z@  @  @J^v` ^v`^ v`^(v` ^0@*v`(v@@\`0^   |~/JL@@ '#(]]Z@ @W  @ hW\0@c @v\ @ \`  `@p "@;^ ^ ?  Ā \@*\`^@*\ @\0h7 ƀ&@wĀ ` @ @^ ? \@ *_uoި%_ov@^ ot`@ow^ w^ w^ w^ (w^ 0ow@^   |~/خ@@ '#(]]Z@  @  @\0@ v\ @+>\`  ~4|8 2@^ \@*\`h @B "H ^Ā @ʹtt>^  ~4|8 2O^ o\@@ov @!\0@ /XbP /]@ץ /8"X@ ] @@@@P  / /%?@!@ת!!@ ;`@_  @ѐ?@@ h @ם?o@i zoǦ0/A( @ X @Ɛ t`0@  @h@ʐ @0`t`8@\`0@\`8\`8@` ~ ~)? @H`  $`.@ `$` b` H$`h3]bt`( ]@,_ a  ,`H'#bp]]\@ @   @Ԑ hW@ ` "HO"qB+0i@ @ichF.p"@.,0!@`H=`w\`@ b@]@\ " ^Z " ^ ^ @@$^^ ?^ _@t`ov@ot`@ ?\vto^on )o) @O\`0oc@^  ^ @x ^*?^ @1^ 0 *\ 8 #\  \  \ @ \ H `H@"mo`io\ Ho\ @@o\ @o\ @ o\ 80 /MX`a~@ ~!"!^ 8^ H Ӫ H< ^ ( @,@8`@{ : ?@bx @9 ]$@ 9 @s@qD?o$@{vu@@]@*' ^ ( @,@8`@S : ?@_bx @9 ]$@ 9 @K@ID?o$@SC a] #?R @(a]@@`@a H 9`!x]K@  <@ < @ ]T @ ]R @5`+< aȘ]Q@ `@ #: /0\ H 4 !*!% Z@@  `]]^[@\]$ <`a] -pR ဖ$]@  $ tTT <H !> !@ ]T@ @+ c@] oQRڰah]oMR ]@H 1 `] ] \X@ \@Qo ` ]][@]@\o 1  ] ] \X@o\`]][@]@\o\\@]1!] o"!]o%@H  @ 1 7 (p o!\  ]\@X`@ @o5`\ ] @Z "O5`\@\o@ 7  ]@x[@*0 og!\ 7 ]Z@[@@o*0 \ 7 ] @Zo*0 \`7 ]@^o*0 ]@`@  \ ][@i7 oӉ*0 \a @K] ? @\ 2O  'ca(]][ @ޔ?\ @ ] ot\7 ]Z@oX` 0]Z[X@y]"?7 Z   o7 7 o\+1`o!8 `oa@`@A $`@6( a]?V @   <@ < a@]Q@ `@ `oThZ !h]R &@ O󀤀 /@ %0] [o7thF O値o ] @`G?o!@!aH]] @ #o`ah] U @?G /G(a]@ H#%?!@`0]f`[ot 2Oe o`$@oL @5$@o=' @](Tp$HtxН@%/Ԉ]Y@@?H@ H\@J@ @\`ot]P\@]J@֐\@K;`ht@ @:\@L`"@{`'@s@1t@]\@ʀg"@Ȑ\@K@ " '`?`?H`t@X!@~] @\!`!@v] @TH!@n] @L!#P@g] @E! cX!@^] @<c`!@V] @4h!@N] @,#p! @F] @$x! @>] H !]@9 %\@`0]!ht@o  '@Not@ o "@@U N@ HQ@MJ @ * 9`@Φ8` @7 LO @̬*J@ * ;`@ΐ; @  * `O* @R@˷< @˵h@΁L "O   o,@˨h  @tL "Oɠ  ` o,@/ਈ#]@˺ a؊c`@]`h;!@˫]!؊㐀@]o`@˝] a؊c@]o @ˏ]'c ? @]oԂ ][@] @ `]s@ /L`c^ @]@G  2H^ ^ T ^ Qc@[] HK ^ J HF^ J HA@K] @6^  #h6 c@@] @   H :@+ cБ< ^ P*0 ]@/[@ @  H O< h ^ #@"] O ^ Ȕ @] H  oڠ @|^ Oɂ @ `H @h < ^`P)0Z  @ `H O<  @ /ήha]`H*@a @z] h @Q H @A 2H ''%]][ @? @͒ `] or@ʼ^@ H +c @ʓ] Hb @͒ @^1#@ʣ] @ h> 9#@ʙ] O @ "O @> O @ "O @ 2O ^ #@z] "Oڰ @r] OҰ !] @ `@)' h> '#]] ?@\) ] ^@a@̼ hm> HGn;9-c# ' )بc! < ^P*0 @8[ "@H O< hL @M @^]@$ O @] O~ @ "Oy @Ò Os @ "On @s 2Oi ^"]]@ "O` @] OZ ]@ "O ]]Z@?@' ]ao^@@  ~d|$/@H=  c@] @] h1B H+ @ * & @1 @ ] Z @rh ' #c]][ @? @  `] r@/s> 1!]@`H#a] Z*@a%] \€"][@!a@7]!] %a] @y\@ 8 ]@q\@ @!h !a] @ O!ot@/-@b \`  \`L H[ YJ @hS `@9] HM HH\`Ȕ @$] @h> \`Xa8@u{] ?Z 5 !!0]@uq\`XZ   ?]  H! @>h@Đ \ ^``@` "O '#`]]^ @-? @ o@#/î<a]\(a] Z@^`@@ˆ H) @y"% Z "ƀ" ^*^h ^`@@s @ "ƀ ^*?^h !! ]@F O֐ot0 /@`w]' @y%p]@\]  @]ƀr`]s9! )]9@u]@ a ]`!ؘ!] ] ]`?] ] $t'@%@%@\@"t''5Ȕ ]a7]]] ] `tt/t@@^ @v^@*`뀡`H`  ] "H[a]\@"€u5\@` @] H)\@@X^ @ H#)!] `@ '9!p]^@ǰ h# ]] ?@I[@^ @`_]@ ^o9 H %] @ @3')oڂ!p!c ]]Z@?@' ^ @ _]@\o)a]@`@  !p]@ф\h%'਺]]Z ?@7^ @]_@_o!]@ot@ "Or^@ `2@]+ap]o[@ ?@~_@-^ @]_^@קo+^ 0`] ov^@;`-]@ז)^ @ג] ^ @׎]^  @ `0] (@ׅ] ^ @`0] !8@{]  ( H H#`P']@@p]^ 0 @+`0]; X`p] @d') 8 `@_] ^ @`h@Z] H@W] H@ ^ X]@uo x@H]  H @ `]< ^ P/p_@ɝ]  H O<  %]a@ɑ]oۈ ap@H]  o$/̐ `]`@7p#] @X[] \ €aa]_@  ] uO#a@_ `]a] ` ]]]]]% p@"s@#@7\@Ā%t@'1ج!]!#]]  wtvu@@]u^ O\ .`@ #\ ##`]]\ ap]@P[@hV @ot`;]ap5]@?^] @ h@@ ?Ҁ`]@ːw@@Ȑ_]\@ 7t@p]@ ^@h&\@7ot@3#`+]ˢap]@\h^@oaw@]@G\ 2OU\oR]ap@t]  o?$ /%ψbH Z p@ 'wwZ pZ[0@]@d '/߮Hb]Y@Āl_R l h@ " r r Hr `  @y v X ƀH c8 c@93# ]#0c(] ]]] sss  sssssss@s9v  #H]@r@#(b@] @os@4\ @txhtX@"@qY@ hq'c#]  ]Z@| zo Fo@ '/cXb]Y@) c0  \   @]ht )o @\ t @ '/?Ȉb]Y@% c  \   @]ht o @\ t  '/8b]Y@@_^ P" \a\ @TZ @\*?\ \a wߒP] w " @t`(t` @t`H@_@t`` @h_\``+`@_ߒ t`h@p "^ H@%@r ]@ @z ^ c0@qm] @Ғ\`p ^ H@u ^ P @h{v P P;c@K]_rhn^ c@ @qJ]  @\`pX`"ƀ X` fP @Ĥ^`@Ğ _ ?`^"ƀ o\`p@X3*\`pX`ƀ#X``9#X@Ķ]@ijc`@į]^ b]@Ĩ @ĥ_*?]^ƀo\`p@j@Ā\`p@d^o @p^@qyo ^ oK o10w @0/3㘐w@ @ '#b]]Z@ {@{  @m hԕH  @@ڰ He"@1\ P@*\ X\ H^ ^ >h@@ 2H _@q_h  Zhې  hՐ#o֢"\ X_ ^@@pqZ @ _ _ _ _  _*?_ \ X[[  @\ H ?ˀo_ [ H@o[ _ _  _ @_ o@LOw\ P"%^@_ ^@@p:Y @:`_`@o) @ _ _ _ ƀ_ @+_ ?^@@p_瀢 H@p^@_ ?yv@ @  eof@p_o_ _ _ @_ o__ ZHoZ \ P?_ ^@@o^ !@!_ _ _ @_ @_ ?o_ _ _ @_ o_@?'Bj*"@ )p /p" Oj@pF_h 3'1c"]][@ @z |\  @] h @C '')/И"] ]  ?@z{\@ ?\@@zuw#]  @$`?@  8  g @ @2H>@ @ H@ > hu@X@P@&@h>~`?`?@@hU@o_hQ@_o@o^@w ]@pe@p`___oȤ"]]\ @z?o"]] Z@?@y o^@b wo] ƀ!^" ]@p7 @p2^ ?oآ"]  ]?@y\@o0 '/Mb]Y@=@,'v@ Z  6w\ \ \  @_t@"@ \\@"\Y \*?wh_ov@^@ov@#(] ]Z@ }@y  @^ ho@ '/Ԉb]Y@@zt@Z ƀ! "q+p^ ^^Bkck@)p@#(p*p#@ 2@k^*^ hfhd1\@# @nr]'Z   0]]\@  ~@yG @ : I\Pƀ\@^@[ @ *@^@^*^\*\Ph2"\^` `"O\@`@ H@n2\@^ ^^ @^?ޠho'#(] ]Z@ }o Qo{@ '/nb]Y@@Ac ] @n, @< \`x  `?~4@@n*^  @'\` @ ~4 H' ^ @n H  tt`x?^ @ ~42O^ hov hvo @ '/Hb]Y@N^@ Gv@^ x@`` ː H^ @  ``  @\@ `  @7  `\`P2 ~4 `@@)?#'^ Y p*@  ^ ~4 2O^ h\` ! ^  Z @m`@m^ o#@mov@o\`@n)v@`$` @ '/Ἀb]Y@Z  ?#  ! Y*? poZ @ww@/H^@  ] P"\ \ @Y "@\ \*?\ \ \ \  \  \*] P^@@@ "u] X^@  |~$@@Sc] P^\ @Z "@\ *̀\\*?\ \ \  \ @\  :\ ]`H `HĀ?@lŀ9u@lt@\ Ā@Y H\ Y @l^Ā@\\tt @l ~$\ |2O] P@mC_h"w@m?^@^v@hv@lQ\o ow"8]@koZZ  ] Ho@6 o '/┈b]Y@Z @'# 9c` `@ 2@]\@*`] ?]`(4% @w_Ā-'"q!/0"H ] \wǒ\wϖ\w\ w\(w^  _@X`'_Z P \   `@e_\*?\ _ X "I]Bjc+0" )0@ ,0"@` @=`@9__]@l"\`Z Z !_]  [ @Bj@ _5_\*] h_[`_   o@\`r@] _\ oos0]?[@]@v˒ @ϔ] _Z `oӰY @k\`"?\Z o\]\`@jߐ?] 2%[`(@lL*H\@_*@X@` "@w_o<\@wwwww\`@jw] _@Ā@l-_o)\@?` `O]"@\?w]\ w]\w\ w\(w@vmw@6] ^ €\*\o@l_o\oZ A_@^  @ /Њ !!a!@G  2H'^^ @ ^ H /`2@^  H\^YZV@M;'c9^"pv]  ][@  @v@? Z 〣 J O߀ @2vo @  ' #bhv] ]^ o ^ H"? @^` 2@^`o @`@^ H'c"P] v`] Z@ @u ^`Y  @X1"`] @  @ @5 (r r r r r /@̈cw]@ Hh"@ He@Ea[_R'W_@1' ]_@k; '@k_@$@Đ?_# @i] w@k@k0_ _]@kԒ@iw@ks@k"_ @)_@# ӟ] @@ @ h#b]]\ @uc?oc"]  ]Z@uX?o0 '/ˮb]Y@@m@o\a@d)\aH@[ @OH1  @@\a@@\ \aH ~|4@HU@hQb1'@R]#]][@? @u1"^`^`]@^`@loOb@3] '#] ]Z@?@t  ^` s"^`]o^`"@] ' oɈb@] oa ] o!2o?r "r r @ r `8"Z`@r Z`0r r r @ '/<㼈b]Y@&"@\!H\!@ @'t!@\!H `Hb!@I] t!H@ꍁ@Yot!H@:o @Oht!Hoڠ@ /耦 @4"Ѐ H   @-" H   @&" h## @ b O 1h"Ȁ @"耦 H   @b؀ @2O 1h "!@b"O 1"]Z Z`Y Y` @@/®wwww@ @"Z@0`@@<@Đb@] @ܐ@9 _bx@K]@_@0/  8`@ s  ' # c @  ]]@s[^0^@@~ '/֮hb]Y@$*w$   _Z`0*\ @#] @m_!'#] ] Z@ @sǒ  @~ hf#`c c]_ H@_f`ڀf hJ!g`ҀihEh`G^@ #@g] @i4V_']]\ @s i`B\㸒 ]  @sy @~? _ @5#hє]@_h!_#@h|] Z #_]F  _w8h@h_h_"3#`p]@_o\c  o] 'Y`wY`wY`wY` wY`(ww ##]]  @i @h? !'1##]] Z@ @s  @}Ւ o @} o^?#@g$]! @h_'c] ]   @r\@\@]  @rݔ oe'oY`or^@_wh _"@ 7#]@a_h oܠ@ ' #/㘈ch ?5^ @H@ @@,\`@@)\`03`@d (cx\`0]@\`@h!@^ @@^ 0@\` 2`@Mcp\` ] \`@@\`0h ]]@rzY@@0 '/[|bw]Y@   Z _z0^ 6\ Y ( "@뀢 2H\  '\  Z(  `@6  @  `@h\@ot@t o@t oZ 8X`(@ov0^@ @^ Y ( "@뀢 H  '@ H HR "@^hM *Z 8  HF @v A h? Z`(@ova1"@^H/a= 2H1 ^*$Z 8 @ ^*Z 8 "O^@bv  o^[`(ov  @? v  o^X`(@ov2H o^@ )/t`]Y@*" @4" @ )/4`]Y@ 4`@ hB @4o 4㽰/w'@4   _yd`?@!^2^ @ @ H 2@^h Z 8X`(h @ 2`_@_#@ H  @ `@ )t P@ " \ \  \ P @А@̐"Hp @_hl @o@o\ P@o\ $cb] v @v 8]^t 0^t 8^t t t @tv \ v \ v (t X_'w@'`3@?t _@= @ؒ O_g[ $ (!=$ \ v\ v \ (@v  )!]  4@3hc@p] h@h_o )^Z 8[`(on@z oPv@@3 1pr  w`0`@  @=@L _f@ ~  ~d~/  @@a @R HO @- `J $#t Pt X] "t`8t`@]Z t 0Zt 8Z t t t @tt`\ /t` *0\  t`(' ww@=kwߐ@E H^ X` $ (=2 $ @ t >@C\ t@\ t`\ (ht`@  "\ @ѐ"@  @͐h @o㾰 @!=/D@hd `^` @="^ @_w_wgwowwwww@ HN_`HK1`#+p% Z@ @ \`8"@ ^@ '@ޒh:  $t`0b^`] t`8^` t`@Zv@Zv`Zv`\`0t\`8t \`@@t .ot`H\`t\` t \`(ot \`8*?٠ ^@1$t`0"^`]t`8^`t`@[v@[ v`[ v`\`0t\`8t o\`@t㾰/ `@2^ @ ^ \ @` \ X 2pt X\@ @)$\ v\ v \ (v \ 8 ht=`@&ot 8_"] [ v[ v [ v  (@<\ @` H[ `@S\@\ P H)!]@ #\ P @c] c@] # @;]o\ @\ @\ P@`2@ t  @\ X`  $2 $@l$t< @\\\uu @u  @)] @ @h @-] h@$ @"h@@@J h"@@D o 㽰 @o?d` /k@_/@?@ d<``fGkb8`@  @h, `^`@:Q^ @`^` @ @^`v^` v ^`(v @Y H h @'v` ^@v^`v o^`@ov` 㾰o\`@\`\  @`5 \ 0`t 0ww @:\ @U H_@y___ww'oZ ( €@C H \t@\ t`\ @t` > @1'o_w\`8/^ @)0`8 @9ݐ@E  @h @;`O_[ @  30$@ _Z8@@/t@I` @h" @H` O@I[``O@IT```  `O ]@1  "H @ ^ @2p^`Z@ 8 @^ @@\ \ @\`@\` @@o@o @I'@  @@@/̈`@N`2H7 @]7 7`@L`o]@/p @KD "@!)h5& !& ]@ 4@ ;^^@ o`P@Ŭ]o^@ @ H)$`!$` ]@`@ 7`@`oҠH@ŏ] o7`/X" N 2Hwh wN @[  7'?`'] w@ "H 7`1 ]@ @ 7`7 sߒ ˰ hw^ Z ( ƀh``(@k] "O7``0@c] "O߷7` 8@[] @7 ߹7` swϔ\˰oԂ @! "@  {h4" @7 O@e'  `? `? @ 7^ F Y@@a^ F  @Y "O7'o7@ @" o҂ |@  " Z Y @@@/@.[ 1p@\@`@]@`@G1`ؕ,p% Z @@՞D  `]@@hB@@ `@]@@@@o'c]  ] @j[D oݐ '#`]] [@j \ @\\ o\  Аo] @Y @L] o .`.@dd@)/Oa ] =! `]@@ ' #/<⠈`ز  @ 2]]Y@@jn@t'> #*] Z@@)/"8 ] ܰ! `]@@/@-r0p2  `]@`` @`H@]A20 @ߐh %@]3@ԨD o%X@]@)/׮  ] ! `]@7@/ȮЀ @X6 1.#X%^@ '3#``] ]_@ 3@i7' `h]]^ o 4 ';#`p]]^@ 5o 1'5#x] 6^@o]7 '#]]_@ oٴ 73 '`c]]^ oϴ 8 ';#`] ]^oŴ 97'1 ]]^@oд & 4XЁ /'w@'{ @, )`]Y@A+@'] `@ @ ( @"0 `@ې?@{!@@s?$ $$$h $  $$ $($$$(`@$,@__  @ wHw  ww@6O'@ H6\pX` @53$`\p\`8@0@/oa(]]7 w@7 H t!]tt2@\hÐZ`( Ā h@  @ "@֨% Ā @ @" @h @ Fo@ o"2 @ @ @P  @ & @ @A?G@ G  $ @HF @!F@^  6@?@}G@ yF$@4 @OoF7p0 {@L oJ$5'3aX]]  @h]@@4@jo@o@Zo @ \  ?#6 o@Wo 8@]  a@@D] @ !]#@.T ]o$ aH@3] @] o"!P@'] O! !]o#@@+oժ㾐w/^ wwww'K`h`H^    &`8h<&`0@` H __v`_v`v`v`_ @ _z_ `?|\@Z 8[` `? 8` "H $\Z 8^ @ "H`0$&`0?%\ _``` @\ Z`@ @4`\Z 8``Z_@ @__ @=@8 @Ԁ@ 2@Ͱ b$ H;$\ 'K[ @*@;$ 1'b#P#$]]`\`\@\`w wwww@7ѐ @@K H_`0 "O\`b$"H6 K"H&b$\ _ @ @&b$h6  @Oo`0`  2O\`_?˒@]o\``0@e`0`@? 2H`8_*3#`8`"@%b \"b$"@ b$Z 8[Ā 2Oe$b$"Hp`0K "H&b$\ ]@ @&b$he`0O @o&b$`2O\B "O\oF$ @] o`8\Z 8[@ @  &`0&`8_ # o&b @]o __@ O_`0 O o&`0b$"H&`0K "O&b$\  ]@OoO@ o@'Ko؂ `0 "@6   og&`0@8 `0 2H6  o 0 /gഊ!]`@^ `EH 6``(p%\@",&h ƀ ^^ v ^ v ^v ^v  o&  !& ] ^ [@v [` ?v [@v [`ov ^ v^ ov & & $& (o& o o& o&  ?'(F1p0@@O뀠h`? ]@`H ?~20'F(@2 o쀠 ?'20F1o60 3a ]@ H ?~'5F30o6 "ƀ ^ ^v ^v ^v ^ov ^ v v ov ^ v^ v^ v^ o{v ~ow& Ԛ ~os&"   ~ 'oFoh"  hofv"( ~@ "HH  o[&"$Y oW&"(oT"(oR&",oO o]h6 ƀ 3Fa ] h@,uh* h @-! h$  !`!@] ?&`EJ`Y`y `? `?O`E)a]@@h@] a ] o " X   $XHl|H (~  /Ӯd!@ Hѐ ] @ @! 䀣 H+! ? @^  t Ar  ؀`H;f<` ܔ @:@ & ؊#& ;>+p@t? uuu H&@ !@9??3&@u@-07`-0 r9 @?p@ ?w@s<s@@"H<  Ј` @0`@ \@]`"@FF]@eY@?@@ @@` "@ @ "@ @` "@  @`@ 耦2@!@ @@`@  @@^ `^ ; tt @\\v H[v @F?@E@O 2@9 @ "@"\@t "@ ^ \^ `"`Y`^ @^ Ȁ O ?h& 0^ @ &o^  & 0^ *@ `<`?hf@^ Ȁ O`o @& 0o& 8F@ 2@ 2O@o^  & 8& 0oܢ? 3= 6p \ Y`  t q`o !`q`ot wY@{!@Fw@J^@oj @:F  dg& OɀoT`&!@* oH@ô & 8o& 0 2H   o& 0"O^ : ]h 7?@@E [[@@*R]+ ?@$@_\<]@*Dou^  o]@9`o뀢?@F  dgo& ЀO@F ?of`@^ Ȁ "Od oL  OS$^ ~R H ԀOL oD'@ ~/a] @  !@@ @ 䀣H!' {$^  t B r %{@`H   ԀH?/p ts >? ?s s   "@H& @"@%9o#(@?ot a?gp@ ?_?9r@!, ?Wq@s?{`"H  В`@9? @7o@\]@`H #dH5  ?? \[`t hp q` %  :@F?@% 耢 H %? ^` h !^@@)R%5@@@'"? ^`@ h%5` @' &`? ^`^@!v`v@78{@@ @@O^ @ )3?@@C ?hZd@@^ Ȁ O) ?hQ& 0?@`@7  ?? * |+0 @y@u@?*@n^ ^ `u 9 t@ђ\] v Hdv @@?@??@%2@.9@o "̀\"t  "@ ^ \^ `"` Y`^ ?@^ Ȁ O?o ^ @&o^ ) ? $o& 0 ? $@@& 0ow& 8?F*p@r @j?F+0@i "Od@_o` 7@ %& 8@oV& 0 5= ?6 \ Y`  t q`o !`q`ot 9W?@Y#"@FW[@FoR g?_F` Y@\@(J^@5` g'@_Z:[o^`@`O@ "@ @ "@ @| "@  @v@ 耦2@! ?{`O7@F  dgo& А `@(!&!o @X' '& 8o[q`[`[`q`" oq`^`#^@eF@~9`o?@F  dgoU& ЀOS9@}F ?of`@^ Ȁ O%oƐ  ?{ O%@^ } H Ԁ`O۠ ?{@o"  ~$~d?/᠒'H 'c!p]][ @a)?@B h@  @' ΀7ѐ    ww5'Z P]ss Y@ @ @w H7ѐ? c swwZ ss[  @ @\  @R?^  Y @?@G`.'' #P?]  77   wwZ ss[@@ ^ dX` @@iGo' Hv ht 1+'!)]c ] ?]@`[@@ h`?@^ hY^ ] _o_aj] '] ]? @`v^oޔ?o )%'!#]S`]][@?@`b @{h+  Ú ? ww'Z P] ss ^    @  ^ f\ @o ox ^ /~tZ ϟ€  '!cϐa @ ]]@`^h ] ?'a]  Z@] @`  @"@/~j&& & & @8 `? `?@@&   h6@Y '!  !  Z B @^@o ][@_])a ]@! @ )/}2a]`@ @$2 6`@Z] @rF?  && 0& 8@ ؀@\:  Ј  @N! <F@+ 耢H  @!:  @&  @@N ܀`@? L  @;L `@7L @3 o& @/ ؤh+& ؀?O値@@@ "@!@: "@!@4` "@ !@.2Ò@! `@%&!oƀ@@nF ?f`o& Z Y`0r@Y`8r`Y`@r`@^  `h@!`h@^   h @&/  "H\ p?"@ \ p Њ``@ 9 @ݑ9 \ pX`8€@@@G  dgo$ / c g`c`g ?`/}ww   (@ 4`4 @ ฐ@fw   H @ T6  va]  v?'   X'  '  ' ' _w _w (' ' w 8w 0@( __w www'_ @+Ö @^ H%_ `^ @' @@, ' @@ @X'vhH@f "  @@/ @-"@[$@%"3 @!h/ @;G@@Ko" @ ?G'@:  @>  @ '@G@ o' #!]]  @^b\@@@(o@% o"0!)psww8s~0ww^ w~^`8 @/|%w?ww` @+ ^`0u^`8t  0uv ^` u^`(w _^Z 8^ ŀ`X @f_&`X^ `\(Ā^``3^ [` @Q_^ Z 8 ]_@ @E__ @? ^ >[ `@r: ~߸w7+ߦ~`F@^`] \@#~ߞ[ `? ] X`"A  $%b]_ __ t`t` t`(_%t`@_t`8@` @F@?0+ @+ p@@]@v`  ]`v`( 8` @^` ?u^`(@u` ` >@?# F@F`@1 @' @D`O@> Oϒ@8` Gɒ@2 GÒ@, O@&  &`@h&`HO^``@O72 @ @*Q@ ͒ @E@ `@`@ "@&_`H`"@`7#~?@ %@_\Z 8_ @ 2O&`Xh`@O7_ O7o&`X \Z 8_  2H\   &`@&`H\  # o&``]@ to  o&`@-@^`(Z?0Y`@]^` 5B?@%\6 0t``u?09Ђ=[ o`s u!?0 ]]g2` \ Y`o7  h$&`@@o\`@ &`@&`Hh  o YZ 8Z@ "H `@o&`X _ _u ovr@/z ^ ƀ9 `H61`1z"(p%^@^v`0^v`8h) ^`0v^`8ov`&` &`&`o& ^v` ^ov`(^` vo^`(@o& o&`o&` ~o&`h o`@XlZ Y`@r@Y`Hr`Y`Pr`@^  `X@!`X@^  `@ \ `Z`8@ X@@@Do\ `@^ (/zp@v (@^@) ]q@@/z  @@; @ )$ ` t t $ 4$ ]q@ )/yЮĈ`]Y@*B 4@ B 4@$%@)p/y|\@ `\ H \ X`0@2O\@ 2^@@5X@ 30^  Z[8@h@&t Hot @@@@1)!]t@/y@!P  @֓0p )a]q@@@@@ 10@!/yh$!]`H !@~@@H&&!]A@@y@@ /yᴈb]q@@/y@V6@>*  @  @@\a]`@@ @s  HP$@ $` $` @G$` @ /@ @> *  H o@3 * @<h,@ O' @@a]@G @sz  2H ,p0 $ $ $ O$ ,p0400@ o2 ?/x'ˀ6  @Y7ɐ!,5s(p !$6w]wwwZ Y Y)#c@ss] ] Z@ϒ @ (ɀ@ _ X` ɀ `?@ @H] Z 6`"@6 h* o7 o"  " _ Z @o_  ao]* 2@ )/x `]Y@  @ " 8@ )/x܈`]Y@ 8`H ]Y@` ` Y@ ? h  Y`2o` h@wo 8@ /xۮ4aР]^"`^  ^ ?h 2o @->`v @v @E@@! @   ҁ@ )/xh`]Y@   8`H  @20^  ,`Z"`Z Z *?Z,`h32oZ Z @2oZ o @o 8@ 1p^  (^Z"`Z Z *?Z (@ ^`r^ 0pr ^ r ^ r ^ r Hv @h^ @ 2oZ Z ^  2oZ ^ `Hr @@ ?*2/w;^ a^^ ^ ^ @]@Y } 8`%^ *?^%!?] [@L  %/w10`H@ &]@Z@8J`{H4  ,@,@-`@(@wϒ ,@"@#`@(@wג ,@@`@(@wߒ }@@, w ZL {OТ @@3ڐ` H@3` H @3̲` H@3ǁ /wx"@_] /\\ @___sss_ssss@s߈\ \s__ osssssss@2 А?__',5/v|(p6 W  $# "(a  ww___wwwwwwwZ __] ss^@]\ Z @4`2 @@3L` @hE @3C` O@3<``O^ Z €@30 `H+^ [ @^` ^`(`H ^ Y` 4"4v`^ \(Ā@3 `H ^ ^`( 0 )/v8la@^@]w @0` @h @2`O_^`v@^`€㾠w߈ >0 7/vؐ 'ww'w _ @_ w_ww@o6` 'cPߖ @+ ]____sssssss!s `?|4@ @ h7`@G @ ___@_t twow}P/uîm~|  " @ސ  _>Sww@?wwwp@!@ @H@^ "-')"]]\@  Q@W @"@%]`89?`h!]`8?6p0:  @  @ )? )@Ц?P@>?`~ @?@t ~W 4t r$` !@>t`@Ȑ@\]>G@,5r * tt`t` t`(u$`t`?]@7t`0p]`t`8]`>t`@]` t`H]` |t`P ]`(_t t`X_t ~__t t _%xt (tt  _t_t@$X@_Z@@c O _}^ Ov _>_Z @1@Z >[~'@q1$9_>_[ 8@ €Z?~>@@s)qt>?7@ r ~'s@t@)3>p~/-p@ r@Z~7P@t@^>"0@~p@ Z>8w3 ~W@@2[ F P`<c  o>*p$`  4`@( ` @4``9>W@ O>_ -#'$ ]]Y@Y`Y`?t t t (t @[@1>7?t 8@ \@E7'#~[~p\ /t Y`^#r ۶~'  >7 @_@\~/p@Z\ ~'tY`^@?@t` @ 1>\  `otto#~k~)@ ?@"!~l)0 @ @ @ "O#35'~]\Y@]   U@U o^(O'$ 2 >_@ _@">_@]^ H 7\G@Z@ "`-`)>>_@X@\_ @"]_t @@?#~__>__^@ Y@Y ] 8~S@O;'$o O`0`O)~[ 4_@_>S@o$@N "O'$1!'>#]^@\] o T '#cb(]]\ o S ' #b ]]^ oؔ R_`(@6  !b`/s](p'ߒ w@>ߒ}@W @a ߀<   |xd @*_''+b]'#}'Ô' '''''`@ ?<   dz8 2Oh:> @  @  P}ϐ `O@> @*Ӱ o%`@(p @ > :0 *'%oѰ ]@T]@@ o̠?'#] ]Z@ O @Tְ @@(!20)p^^@a\ ?2^ @W\ ?3@v @N\`(  (!10,pvv0/rD@Ģ  @Δ ?@b wߡ: 77w'@Ȕ  H$@S (@  ,p0,5*20  r r rr r 1pt  @ ?@9: @  H"xƀ ]!ߞ"p]@֐@rh) !@! (@Ѵ  r r r r\-r `t] @  h oւboӂ"h o΂"/r`@K^ ``q+p`Ȓ%Z@@ 'P @ $] H ]  HhM1)^`#@\]ϟ H]___@ 10Z Y@"`GY Y *?Y_^ @"`8^  @K (%_ϋ4r_r _r _r r \@ @t@ w (`x@ ] H"]H )! "]]@@X` @Y  oq` _瀣"g۰ owǀ2oY Y oo@ אh)^`@[ ] ϟ@ G!wǃ40\@   ^_π@ "`^ ^ *?^%(x@ ] Hu "]Ho )o_׀ 2owǐ^ t @oot@^`)c@Z ] ϟ@ O___@z 2pZ" wY@"`Y Y *?Y"@w\`w%(x@ O] H6 "]H0 )or2oY Y oo'^`P[`]  O$2@ @ )] H%]`H )oL@h@ +d؝%'/qNP$]b(wwwwww^`]Y @ HL_@_2Z   Y"`8Y Y *?Y@__ P#a `] ] wwww@ єh+@ h'_@_ 10Z  Y"` Y Y *?Y ܊ h`2oY Y oo`2oY Y oŊo^ /p``Yp+p!P%Z@'cP @ ] hV$%c#]wwwww^`]][@ H@ h:@ @ h @ ^`\` h&@ o^`#$!%c#o͊ $'&%#XoƊ ('a؂Po"P@ Uh '##P8obHt؝@@:(!)pZ \"`\ \ (*?\h € \ oh @ 2O\ (o\ /pK\\cee)0 b w7@  b]&@^ ^^ ^ ^ wwwww_Z @"`GZ  0@ F_r_t @0_t @-_t @*t \ @0\  (!  @\ @? h%@;o@7o\ @3o\ t (*\@*Z (t@h "r (Y (  or (o\ @t_׀`?/oҮ\\cee)0 b w7@  b]&@/o<@ @C (!)0Z "\\@"`\ \ (*?\h1=`\@2o\J@!]@ޔ 2@\   \ (v (@\`@\`@\` @Ɛoou@ O h =`@\  Oߐoΰ  @@@!/oe"]Y@J`@;@>"^^ ^  "^ ^ Z @"` ^ "В] ] h)vJ`"@^`"^`@W"Д"] ] r_@H@`2H] ""]]wmh "@>^`hw@bo"] @ /n㨈bX]@Ґ@/n |@(!b*pZ ]v@`HY` `@c耢@H `X@H ``  ?^   (Z 08`@A `" `#``H`$^``h ` $``$ "@`0`,#`0"`!@`@``H`H$ `&@`@`hЊ :\`@QhɊ \`@K:` 1`*0o`"@5^ @+ 2@`h @* H ` H`@+ H ^`h`@* H ` @* H `(@* H `0@ H @`H[ 0 ?ɚ v@ @``Hz&``v`hu  v` v` `0v`(&`0  @$`耢H`\`*@`@2 t`X `^ Z 0 ?€8`GD`\`@В^ [ 0@ .`H&`H $`` H; !#耢 H6 \`  @2 t`. ` ^ Y 0:@D`\`oU`@*\` H h @*U H `X@,n 2O`h  `\`@*ː O @@*=`/` H(p@+  @*@@/m‒@*=  H@* H    b耡`H ]@) @ &`v` H@*``H@)`H@*`H @*` H@* @ /ml`"H. 0`@ &@ v`@`"@ H ` `H?^ v`^ (h:v`H8^ 8v`o^ @h2&` `"H  `@0`  &@v`ov` o&@ H h&@H1 1 ;m(p`%_@@o o&@o o o o  &@v`ov`ԝ@@) H`@`@`H  @)s@)` H@) @'` H @)^ H ``@`@` h  @)i`( H @)d^`(^` @@)Z` H! @)R?`40  H @*v`40 `H @*m` 40 H @*d@ 0 $ c`?/l^@ zt@)8'  @ 0뀢@ `H]^@[`(w@' @`"H^@oo߲(Ξ@?/lƮ\w@I' d?!,56s (p !K bb] ] cwwwww]Z X`X@ $ &#`Xss] ] Z@ @* _3J @ .@ 6p$@\ Z <h'@  @ 6@r_o\ A3p2$@ @\ Y @o\ 1A60  3$@$@ h  10 $@@/k㄀Hi `?#d@H )d#d> `9` HU)] @ @D6@[<^`ƀ$ H H @` @&` & H `H$` &` & &H^ @*^* @ϐ " " ^`$r`` v`@|&` >jJ"h$`@;oIJ@c > < @] o@/k@c@?@6h !H 9 6=ʥfɸ @@))a  ]=`#8c@#H@HI@16` @O` "@5@}2@@  @ O値@ @hp= @ƨ? ~o"@@xB>@]o `$O쀥 @@B@iB>]@o߀ `$O܀ >@w]o׀ @ɐo6`=`6`@  H%))] @ $H6= c(@^] h0= ]O@)B#0@P]o 1p`Oo@  @=`\  @ H = o]@o @So=`  /jѮ'ې@M  @#P )a] X H@#`@]ho]@]o )@@@@ 10B" @@ /j耦 @ #   H#h  @c1#]@@[ !1pZ  @^*?  H @  "X#n !2p\@@@= @  !" 10\rt@\ ?  @@`Y@*? h Z "?\  ! Y*? o\ ! : @ @ @< ^ jJ@"  ! :@"^*?    /i'ے@ۀ @6` Z (`:`  H  @ Z*? h  cP@]@@ !1pZ\@\`@2X@ ?@. !20t@P @ K@` @/i@4^ 8 `@/ `@'cp] ] Z@?@Kc  ? @א cx@!] @V h  `@   @c  "@ @@ѐhѐ  @DE '2 2@!)@ '\@@@u G@D=Z \"€ D`\@ "@.\ \*?D` '(p @k#? @ '㨊#]]?Z@@J  @UŐ Z c@] ^ 8 HZ [ ( h*̀ o   'c#]]  ?\@J#@ @R3#xc@]  ?\@J] @"* @> )a] @'@W]^ 8 Z Z( Ho\#c] ] Z@? @J! @(p ? @#x@`]^ 8 HZ \(@ o:!]`@"@ \@@!]  $H @]h  @ϑ* oc@]o@@  ' 10"@@  1pr@@ y 1pr@/h@ k @# @ @T  1pZ@#&`# ]]1p2pv@v@h    @*a o#2Z*Z%(ao X`8ov@@/h@ / 1p(Y @]q @@/h@  1p%Y @]q @@$)0 ?#@ Y@  $OY?H < : +@r @4H&@@$)0 ?#@Y@`  $OY?H < +0\@@h: @t@@ H? @ $+< )0\*@? O< &@ 0/g;܋20^@@- ' #c  ?]]@Iv[@?@Ulh_v @^   @ X@Y X@^ ZX`h@v 0@ z@F @ (Y` h @,w\`h@ r r r  2\q@ot@  @ "@E0@ J@_* Z  Z10t@r@,Òhoq@@ . 2pZ ^ "`^ ^*?^ hv2ov '@1'wwwww'^ Y @ '@' www'^ X`@ '@ ' www'^ X`@ '@' www'^ X`@ ''''^ X`@ @ '@'www'^ Y @ ''@ www'ww^ Y @@?*0 @Ȑ> @@ @ z! ?Ђ wߐ& T^ Y@ 2@ ^` _߰Ш`M<@hI^` ^`(^`0^`8^`@?wwwwwww@v /`Gފ 3 6p?\@ __Z @ "`Z Z*?Z `@|o o @` @ eP@ ogZ  o 2 Qo @  @ @ #>10?@ @ @@x+)@>@w?Р/@ >`,0?wwǑf@w! >@: 9 $++0@X@/ D #1p@ @$@\?\ @@0@\?\ Z`Ā @ "@\ o&@X`0o&@@ Oʈ+>`H > ?'@ O>h=Ѭ "O\_ƀ_ oǭd`@@ m@^ Y 0@@@ q%@$)p\@`` H 9 @ H2O\@r 0 @#@@ @"`` @h* ` O``O@!`O@!` O@!`( Oݐ@!Ȱ  "H @ ^ 8^ h ^ @v o\ 8@@ @  @  `@@$ )p;`+`Z@ @@Y`*@!`O;` Z hZ `Z X# @/d|@ &$^`0bv ] ^`8^ 8v ^`@ Ev (2p"X^ 8 `h`H    h0f`AI2Z *@%^ 8 @ `@ @ !=@ `h `"@ @-ց@1 2H  `"@ @`"@  @18 ` @ oي @@   E10B"@ )/d`]Y@*r @ r @@ f AI1pr@'#/d c  @ ?]] [@F)  @P@1Y@`@ ՠ H! `!=@ H ^`8^`0`X``@h<`@ Oo@ /dB@  H. !=`X@h% \`@h @ Oֽ O@._# `H ֮]  /c'wwא @ H ?_ω1p0@h)] ` H __@ @g @:] _1@@g @nw@$ "@  @@<ߐ@Pˀ @ဢ Hwߞ 7w@% &@`5'@;ˀ @P '@M Ȁ @; @ 1"" ? " @  $"`][`[@[`]r pr Xr `r hr r O"@ !hl@  @$2@h` h\ @ o"'1c h]][  @E"@:o値#``]  Z] o 3`X]]Z@ @E  @@Ґò@ ' c] "`PZ]  @D @O<o  @  ?O^')]`$@  @5B@bH@z] 0  @/c@Y' @n N( @h(pA`06`] 6" 13 c*] 1p6p`$@$@$@$@@* @! `X v `]&v v pv <  ?30@ ڐ@ 400 @/'  @( h@$@!h @M o"@F  h "@@   p"@]  )/bX- x^ p #ئߠ` ww` ȸд`wcFww'@>l?2@: @ `"OF@ G@''] ]?@D.\@FF'@ @р2@; ] ?@D\7) @s/p Ӡ@o/0   ]a@8@@B@sː]_\%@<hh@_]] ?@C_@U@_hVto]@B* @w_@<*p @q_] ?@C\ _@_]^ ` ]?@C\@",0 )a ]@ao]?@C\)) +0 @! Ӡ@ * ] o`@ϐ " " " $" (h" P @/aҮ`HH;^ pa6`!H*% Z@  hYrvv&vvv v(?& &hK ^ hGs o[  1~ 5 c6@ O2po#  co20 c 1ph,&h* ƀ  2p ]F@ h:   3 @ ;h ()p H 3  6p[h v  ~h& Po#: D,DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDL'/`Ϯ ^ ]`3^ p^ 0*@,v 0^ 8 @%?@ m3F ^ ]@`  @D^ @@h2 @ a \X`8Āo^ @o@o^ 8"*p`H`)!] `@}`)'##c]] ?@B?]@ F'@ @အ 2@. ]`]? @B))) @,0 @}*p ! ] !@F@"*p@"@B! ]a@5] o^ 0ϑ+p @]@@W* @ ]] @A? @ ^ ]@`]#В ]@A?))@7(p ! ]@ao]oG`2OF^ 0o)'@b^ p@` /_㨊 ]`@>? www瀧 wײH  79&  (Э0p20 ^ P€R& T`@F]`@D^@@ @ @@T "O^ P^ p@$hq?@F"*p$o^ p@>o"(^ p,H ? ^`h ^@@hRF` @^@` '= o^`@I<`o @F@]@!, #ws ;` @ O`@ o"  !@] "?v>J`Y`y `? `?"Ol>')]@@+`@]  (]o[%  wϡf`ww粇w/_@ึϰ @P\`p (20(p (()p! @e]`2Ha^ #@  dH ? __πhJww :@D@?@3H : ^ 8hF ^@;@? ^@ h&@ ?';^^!vv`O h-> @^ ' 8`o^@iO퀦`@c",?&h&!_wwwo ^#@e D@^@9`o?0^ p  $ ` H@ @H H ^@ h t @)"$*0$/^ ^ ]hx ' @@xD@@ t 8`s  @ Ha `8] @R `HW D@@r;'D@@*  @(\`p*@ @4 РD@ @@$?@!@r4D@ H4 @` @.@ @( @` @"@ Hh @ oݱdg(2+p@ @@T oǞО ]@a z$o$@Y p`H   Y @ @ @R  f`@^ p@`^ p 1$ \ v@1p `H \` Z@ @- @12 HH 1\`[ @ @ 13h $ @o1@o: @^ p `@!`0?)0 @@ӐF@?`@9`t@s  @ɰ  f`  @'/]c ] ] Z@?I @6`@ @ ^ p")p&@^ p @  ?/]x'@_ %@@@O<`ߐ@ۀ @6 ' @ '  @0p!g@` 3 @$v p  @  X" *]t v `v v &v xhZ@!  "]@hP #]]Z @> @ Oh> @ "`@] "H4 o<`  @ ?@wߖ : 7wߐ@ٔ O 1'!# ]] [ @> @A@woΐ '#]]Z@ @> o!(p c@0^ x `  F& ^ pD@ @;?@@N O  H'  \$Z`(@ В H "^@*t`\@*€h @d߀ "H   FG_@  `@$Z x`H``"@rh Yr"rrr r(?" "h @ `G2H   zh " PY` hrZ q`9 @^ x^ 0 @"\ 8 @?@ D\ @ \`Y 8@`@\ p@@@o\`@o@v 0o\ 8@"^ x+p\@ \`\\*k@J#@ 1 )pZ" ^`(\ "`\ \ @"^`(o\` t0^` t(^`t  $8 $< $$@ (h$D\0@2o\ @\ \( 2o\ @\ \  8@ oޔ @h 2O\ @\ 0 v\ 8v @^ x@`@^ x $\ Z(@ \v@/ H\ Z @^ p<`F  @= 8 h 0`" +p\{4@H@<@^ x `@!`@"^ x*p/[8t\@\ \ )0Zƀ2 \^*p\ kJ# 3 (pZ @  @"` Y@Y@Y @ @€2oY@Y@)^@q@h:^0'  زc]]]\a  a@=;] @d@ؒ H@@Ӓ  )'a #] ] ]^@ o c ) 'c#! `]] ] aX@ o֔ bv8`^ pv0 v p@ @\`"v+p\ 0v\ (v\ v\ 8v \ @v(^ x\ ZY+0n@N&@1`*Zv@\ r\ \ +0 s@\n@N&@t @$/[ p $] `@ @ $!] @& N@&) @] h] @#]o$@$/ZЮt"`a]$@a`H 1)] @ ]  #] cZ] @  ][@ $/Zaؒ @] $ H!p)] `@@P !@] o]#@@/Zx $b`]!@@w@0`@4^@` H `Hz "x \"t@\ thm '? w4p @8  `@]\\|4'ZP€ @S〢`O hN?#w_ @ w4 @ @>\Y H@〢 @6 〡`@2 o\@ @_o\\X` \[`0  4 \[(@ H 4 @ @ @g_ @ rov@0/Z뀠`@ $` ` @ `H@]h^ Y H@ H  ` @hv@Q0`@\` H$ `H @ ' \`\@ 〡 @ ?'v@v`h @$o!@\`o'` @w@t  〢@t\`\{t'[ P`@i〢`"H\@\` @`\@ \|t'[P〢 @T 〦`OѰ hN`w @@@ @C\ZH@〢 @<t`〢 "H \`Ր @1\[ H〢 @) 〣`@% \X` \Z`0  4 \[(@ H  @ \@t@o@Ȱ r or@ $/Y"`]@ X@ $/Yt`]@ X@@` H @@ @ $/Yc]@ @^@@  HD 8H ?7 10 i@H`H5 N@ 7 @@ @ @ O @h<@4^@ov@`"@ O〦`O߰ hH  2`@*  ?v@@M  "@ @6 @ @  O @ /X@av ]&v  Z Y@ `q@ Z Y@ @ q@Z   ``? Z Y@ `q@ Z Y@ `q@  /XDb ]@`HY! ] ] @~!@ t] t'%Ƞ`]@~] t@b]t@!Д] ]o\@ /@oo@ܐ@ H (a]#@\@a /]@]@ʐ@ 2H\@&]"\@!] /@J@@v H'$]$@ @!@?& /W@Ko@ >@ !`! a /`@ & h&]] [@] @|@;o H & B @^@@v@ @ H@ @o @ /WFp Hc:   @Y HQ a^ (@]@ݐ 8@; , ,`"H* !]@^ @ɐ @ , ,$F 8`@C`.F @e?h)& 2b@] @o !  ]@^ o2"@] @oà 0b 4]^ (@o@ /Wڮ H( @ 9   @ 8 h& @$?O& @faЈ! @ /`O]]@W[@@o` @ `1``H1` `@ @O""  /V㤀 H%]\@@\o@X H< @ @H-` (] & ] Z_ /@@@> @h&@#a0]@(  "H La8 @] 2H+L _d@ @\,@@ "H&+aЖ@`] ] ] ] /@ܐ@I@`?ƀh&>` _'ې@<ۀ HQ@e'ې@ۀ @@ ?//ߦ@ @2 aP]@a] ]\ /@@ @< @ ! @@ )!]@ @15h@]h+#@;! @& h @ hߐ@o@` @2 X]@po5Ho]o;0)/VDaА   `@ ]@ @p@q]h*,@0 xaƀ ]@f^3a Ha]@3]^@.  4 4  ] `4 s@# /Uy<a`a]!РoY@ / @ ] @ ] @x@7o`?/U[a`a]!РoY@ / @ ] @] @Z@o`?0/U>P`(]]И!@Y@ /4 (] @] @w : !@@1!;`瀣`@ ]@({ @_@e4 hoxT@/UL @Đ   "PbX ]" h]v r pr 0r "&v & (h @װ  "@/UۮȒ @   "PbX " h]v ]r pr 8r "&v & (h @  "   @@@/U( @ ^@ $@u"@ hv@ h 3bP$ hX] v v & (]  t p$t 0t &h o @  h"@  o h0^ Y`P  ` ``DY`H h q`PY`pZ`r@ &@`h&`@- O0^ [`( ` ``[`  hs`([`p[`s@@ !@` !`h  @Jho@^ ƀ\`HD`D`T@H$`@4 \`8 @ \`0@t`Pt`H\`H"t`@2O\`Hh  h @t`H?t`P\`p Z@hr@@\`Pg0`$@h@\`P\`pt`P[@os@@^ #@  @ ,$g @H! `@*@6 \ @, @ @\(g4`&@5@\(\pt(Z@@r@2O\ h @ Oh4`@ @&\p[@os@^ ` @3 `"@\ HH-\ ( ` )>` \ @@@h"t (\ p[@s@h\ PD D @ ` ` >`D D\ H@@ 8hot P@o\ P@ /Sl b8^ @]'@@`H 2HK ^ P] "` hB \ 1`\ (@ `3 1` ,@ !f@2 <\ (@ @  0] `H<`  <`ƀ @ H ": \ (\ p@: t (^h v'@o@  @  o\ @^ & ( $ ,"@ $ \ @ 6@\ t (t \ ?hD h$ \ \  z4@ @t Ot ($ \ @ot (@/SݮЊ"P^ ]^ `? @& ( \ 8 @ \ 0\ Ht Ht P\ H@?h D Dht @ @\ Hot H0s   @ @ /S "@bH]] H# \ b`H' X]6w xƀ' \ hw ` ?' h_ `@ h $@}{  h"@~n hw `o @@ @ @@^ D XD \@~\ ` @: "@  \@}X  "OD Xh  @ $ \: v\ ` w2wע^ ww\ x &π`"@  \D X^@@~t^`?@: ^`@ h$@` "`:`^`^@!v`ov@@}   O䀤`h&h \ `@ߕ: "Oڀ`? @\ xoԀ`0^ [`P  ` ``D[`H h @v@[`P[`ps`PZ`rh  ° Hov@0^ [`(  ` ``[`  8h``!@[`([`ps`(Z`rh  ` '뀢 2H @`H^ `H?D D\ H@\ P@`  ( L` T& (h !o ( ( $ o ,1  (8 Z `?`?@H  H2` @h [`H[`P@ [`p"Y@@q@os`P[` [`(@[`p"Z@@r@os`(@^ \ `  h  @ ``@  @{ ``H@|.h v @@|*\ `o Ro `v @vv v v v v (v 0v 8@/QP✀`@   `H 68h @ Z  ƀ"Xhr po]0^ Y`P  ` ``DY`H h q`PY`pZ`r@ h&@ O0^ @[`('[`(   `[` @h  #[`([`ps`(Z`rh 2H @ `H^ `H\ H@\ @\ P@ `@  Th " \ Ho\ @ \ @ ,"9 @ /Qbh& (]&v v v  (  @ " (Z  @r@Z `r  ( `H " (Z `  @Z `r  @ (6!@ & (@ @^ ^  @v @΀  (6@ H "@& (@^ ^ @v    $ !@1 B (Z Z @  h @" (r    `@   (:` H" Y ! (@ q  ``? (Z  `@" ( "@Z `r  (Z ? H  " ( @#@Z `r   (Z  `@ " ( "@ "`Z `r  (Z `H  " ( @!@`!`Z `r  B (@/Px @{ϒ!H`` " "r r r r ` H`$ @')]`@1"@]@z hx^`^`0] r!@r!8t0@t4 @{1`Xt   HOt @)] @#b@]@z\oؐx]4`@Qt(  @{}0`.t! "v ]v v  4\b]"^@5 ] t]t tt $ttt$tt$t$tt$8h @zu o" oĂ"@zn o"^`^`(] tot@zb  "w'w'w''V w'w''w'H0^ Y! ``Y Y!#h`q!q Y Zr@ &@`h&`@, O@^  \ \ ` ` `\ t  Z r@#@`h #` \ $ ̟@ Ho\ @^ ƀ! `H ! @\  @`2O! h @g0`$@@@ @ \ Y@q@\!"ot!@ c?@/^ @C  "@\g2& @&@\\ t\@ @t@\\ ` 2Oh" $\  Oh\ 4`  H  \$̴&Z@rА`o$Z @=  "@[`H7[`2`@[`@h0[`@h,``Ѐ"@[`h% [`Z"@r hs`2`[` " [a@o @@ h aa@ H  "@ [`Z r[as` sa @^ ` @; @ "@\!H5\ ` 1>`\ @h,t \ Y@qh%*\ !`G\ @ @\!"!\ ` ! @ H>`\!@ h \!t $@\ t!oڢ@^ 3 8 "H\ \ @ ' @\ \  !H@xv@x^ v @vv v v v v (v 0hv 8@xov @@xo @xo\ \ x@\ `o\ @^ /N\!1:\!@( `@-!`@t!\!,?\!!"O\!\ `"$!1)!]`@ "@l]h h \ € 2O\!h! "Oг:o\ @^ /M\!7   `H&@)] `@ \ \! ⠗{t] D!@9\!  H! `H \ \!`)$!h &@aВ $!]@ G@]h ! Oˊ oɢ 0/M:p"]@`H^  8`"H^\  P2H\!\ \!@ `Y \!$M!\! @ @M !`@8t!\!,?\!!`"O\! 8"H\  PH: \ \! `5 #c]`H. `1  @ a`2 )@@@ \!@ oh \!@ h h \  2O\!h `"O\!o 8\!@ o @/Mɮ଀`@ ^ `̀ H`$ ]@`H`[`[` `$`2H#`̀ 2H #``[`2`[`*h [`#`̐ [`    h[` # ?@#[`s`h s`3#`]#o[`Z  Y Y @ y$ @^ @$'@>Ā : ?@@&@$`Oh  o@^!8$@ @'@>< ?@ @`: H"@$  O: `O>h &$o @ƀ! @ H `@  @ @ `2O!h 4`@^ g1 $@@ s@^ @ov   8)/Lla'`H ]@ @@]h. ^  !  @`9`^ &!' @v ΀v! s^ (^ @ H G @ v h v!s^ (^ ƀ o 0 P'`@^ Xf4`@ @ P^ X"'!@@& Pv X @   s^ (^  H   @#`?8` !@H"0`"H^  '^!^ `s^ (v ^  @ @ G^  v!, h  @oe@^ eP0`&@ov  c/e  ?0`0 /KQ̈bТ]^ @` ^ H 6 @w9@ H@ @@vh @uh  8 Oဦ^`@"`~^`?@ ! H!`2@ 6\ @ "@62O! hm  @v?ؠ@roe@@+! @H@@<\ @ *8'\  ' @+' \ <`Z r뀢`$@\ !\ `t $!Gt!$4O!\!<$@ &ot!@ t!t  ˔ 2O$o6\!8\ [oբo͘ ^`fZ 4`\  @<`\ @\ t [os8Oo[0/J`^  @ ?&Z ] @ "` 843h O4^`@"`^`\!\ \ \ %  e0dp@( ! `H7!`@&4! " `@2H\ \ `@\ @ @4\ \ \! {@ @2O! @2H&h 4 @v@@uh g@ <`y8@@\ ! H_H<` `"׬ @ `*S'\  '  @F' \ > X@@ p@\!! t!뀤@/$!\  t $!\ G t!G z @@ $@<` {x2O\ \   o  G \ \ \!@o{$\  t!t oڦ`?\!8\ moo ` %f6    zg @ "H^`? 6 ^`Y`@\ @) > \ @\ t @Z$r\!#ot!> @  zg  O6 `oݰ& `*j!oH`8"O\!o4@ /I㤂"^ ]@h^ pa0 a pa(@/Iwd "[]@` [Y`@/If `^ H, I6`"H*% Z@@h!: @1h:  8 h&@ʐ h: @  h: "ƀs h  bo]  [    : tdԝ@^  8/I HE T\ \ "    ``$!\ $  bb]]t t \ @ €# @\ \ `$ T ?  t t @t!\ `v@\ hv`\ pv`\ xv`\ v`(\ v`0\ v` t `$ 8t ht pt xt ht \ x\ `t @o$ H@^  8/I̮฀ HE ^@B^`@?^`@< ^`ʀ9 \ \ "    `$!\ @$ ! # &"pa\ ] ] "$ <$ Pt Xt t t @$ H$ T^@ t `^`t h^`t p^`t x^`(t ^`0t ^` t t t!t $ 80 ''@> ^@   +p @ < `+p^@ ?'\0\   H$: ^@! ` @  +p\0@^@D` D`\\`< .0 : @ @\`@  `O+p 0 @O T @A$Tv  HD9 ``@"  ,p@ @# 瀡@ @5,p@^@D ]< @ +p @!@` O'h "> @rѐh>  @ @s!  ?v@h 8  H  0^ Ya  `Y`Ya#hv@YaY``qaq`Y`Z`rh  а Hov@@^  \ \ `  ` t ` !@\ Z@hr@t \   @$ ̀ H\ `ot @`H^ `@?^!*!!`@ ^ @ "@!^!"?!!^ &!^ !h 3 h2  ^ & o^ 0^ Y! ``Y Y!#h `q!q Y Zr@ h&@_ O@^  \ \ `  ` @!@ \ \  t Zh r \ $ ̟@ Ho\ @? H^  H\!*\!!`@\ @ @ \!"!\!\ # \!hd h   !@8`@^!@>@?``?@>^ ƀ H ?` @H @^ ^ !@`3 d`@";^ ^ !  В`v ; & v ^ 0^ ^ ^ "`! /G|d` @ ! ^ ^ wߠ ^ )  :'` gpH$'ː^ 0^ ˖  @ H 2Hl <w ^ , : ` h' @Pߨ^ h^ `$^ @%)] @ @3^ ^ `] @ h_ @4h[ ^ h^ `@ %)G^ 0@'˔^  Ā_π "H^ `^ x^ `o^ x@h; @4f@ $O^ @] o^ ^  Ь`& v v h&  e  H'瀦`! d`wߙ:$ o ^ ` 2@^ oo^ `?k-)] $H o0/F| Ӡ H:  1`)@$!t!]`"H- ! "H) ! @@h# l H\!(*@! #]H  )a] `@@p]2 b\!@] h@\!0 /F`'ې  H  @1`^ * 1`! )@ <&!@ H' )a]`&@ @p+2 G@a]h ] `"H ^ @! `"H^ @@@@^ @ 3 @瀢 Hr @: wG H @@p:_hd ^ p@^ `@p1_)& Hav @]  $HS @3hN ^ @F Hv!v!v v hE ^ x@^ `v @& Hv v!v ov! H ^!( @c]@ "O^ @)]@&G^ @@o2 G@] o^ @@^!0h ^ `& T )]`$H  oS  H odہ@^@ `@6 H`@ h ^@ @h> @o^@ov@@p v@@ 0`@%` @ `H7 ^@@4 @o^@h.v@^@ ^ xt'Z`P 뀢 H!뀡 H ^@h^ ZH€뀢 H 뀢 2H^@v@h   ?6@p|  ?v@@ /Dc &]v v v & (0^  @r  h  v@0^ `' @r   xd@  ƀ>h @r^  g @  ƀ>h @r^  g @@r^ 2 @^ @qɔ 80`9  Z @oƞ@ 0^  @re  h  &@0^ @' @r\   xd0^ ߒ @rJ  h &`&@ 0`@''^ ߒ @r=   xd  @  y4zt@f@`S ^`Z. #?^[ hH: ?@< `1 ^` $ e\ 2`& @  @ ~4@ 2O^ H$ ^\@@  @ h@ ^[ @o@ ^[0@4 ʐ@&oۀ^oY`: /Cܐw_  H2 @o| Ā) @ @nAh@  O # ]@n)o @ #/CĂ @]@ #/C␂ @]@n  @@ H ^ @@ @ ^*?  h@R@@`@  `H ^ Y@h^ oY`@`@  `H^ Z€`: hv@^ Y @0뀠`@`@h ^ ZH@ H 뀠 @ o&@@^ @ 'ZP@@`@  `H ^ Y`Hh^ oY`P@@`@  `H ^ Y`Xh^ oY``@@/B<Ȓ΀5 @1H  !@@ H* ^ 2[` H" H 34 c0^ ][@h^ 2Y @ H  H  ^ c(4 ] oZ   @ @ /B⨀`@:`*H`Hk ^@ hf @m hbv@ H^'\ Y P@ۀ HV\ Z ^@ HN۟:3 ? @ hE: 5 !@0\ 6`X`]h9: ^ Y Hۀ H1 ۀ@H-`&H* 9`2@ !@@ #^@@1`\ ^@Y` H O͐ \ 6^@h : @ 3 @mΐ ?v@ /Bz`@J`*H^@`H ^@ h{ @l hwv@ 5  @Hq'\ Y P@ۀ Hiۙ: 3  " @ #@"@ 2 ^@\ Z  HT @ hO: \ c06][@hE:  o'@l; ô^ Y H€ۀ H6 ۀH2: 3  " @ #@^@@\ 0`Y ^@ ^@Gۀ H)@Oǐ \ 6Z`@h:  o   @mB0`v@o?0p n@(@@0`'l``?@ @H: Gv@0`'m``?@ @H: v@0@'D``?@ @H: &@0@'E``?@ @H: &@0V@'``?@ @H: 6@0@'``?@ @H: 6@0`'``?@ @H: Gv@0N@'``?@ @H: .@@/@ȀH)63?`Љ/p%^@@ .  . . . . . .  .  .  .  .  .  .  .  h?.` A7 cp] @@ @g @Hi` @e `?& ?@Z[[v[?v [v [ v [(v [0v ([8v 0[@v 8[Hv @[Pv H[Xv P[`v X[hv `[pv h[xv p[v x[v [v [v [࠺v ` _`v@`_`v`_`v`_` v`_`(v` _`0v`(_`8v`0_`@v`8_`Hv`@_`Pv`H_`Xv`P_``v`X_`hv``_`pv`h_`xv`p_`v`x_`v`_`v`_`v`Ov`@Z6&`&  & & & & &  & $& (& $,& (0& ,4& 08& 4<& 8@& <D& @H& DL& HPP& L`P P`'@`P`'`` '``'` `'``'``'`` '``$'` `('`$`,'`(`0'`,`4'`0`8'`4`<'`8`@'`<`D'`@`H'`D`L'`HO'`L61``'.pHX& ?.pb%Y@@& & & & & & & |& |x& xt& tp& pl& lh& hd& d`& `\& \X& XT& TP& PL& LH& HD& D@& @<& <8& 84& 40& 0,& ,(& ($& $ & & & & &  & & & &.pH"@ (O o o. 6@jV|tld\TLD<4,$ |tlxph`XPH@@ /?D#8]`H##h](@`@ c H@ h$]@lUZ p?$@J]`Y`y$`?`?#~/>|#@%]? ?@l3)@"PcX] ] @i @iÔ @2< @ @j;cpI@`Y`y]`?`?@i$@+(cpc!]@h\@ ]#`] ` nf`Y@h\@l H@ih| @ǐ';PcpZ]  t"@kϬ '*c },< k'Р +!@*0@*#:(p\@t@`t@Ot@cp+]'%!Pϫ-0 @k#  }a,< kgР *p" )p +#@:(p\@ t@?t@Ot@  @k@h___##@ -0,"@")0(p#$--p@___" )p"@ *0@cp ]doo$@HoG] 0@@ @: ҙ2h: @h? {h "'߈ '7''o@/=v @ic $   (p@iZ @hN@h|B@*d@p "?+@$@($"*] ($@)pt6`$@t t @t@^ >`/=î@oߐ @)!]@`@  @*2@y] o  @i  @h: oB"r ^ q`@ov "+0&H&($,p+ `* 3)& aВ]&`H :`1#] ^@x @/=vᴀ@F^ \  )!aК#]\@@Y   )] `@>`#@x] @ob!940 @)͑ `@>`$.p\ @"`Y`^ @ "`v @oN\@^ @ght@t o\@] Y @xo\@)!]@`@@x]  @/=Xƀ.^ $^(pv  ^q` @ ~@H)]@`@#@xl] h%  `?~ H ( )a]`@ #@xZ]h( ` Oڀ)a] @5]@xIo̲(  *+p& v $.pv~!^ )0/<ʮ$\I )9??-w@v@#]И( sc.pr!*`@*?$-0.p `@)d`v @gZ"+  `:@n @@"  @$;\ ?Ք!h  --0\\ @?;)]@`G;@*+o\@Np<\  |4|x@? ǖ@3s $u@?ǫ-@'@X@^#؈?] r3Z@x@? s@ cr\ t@nKD 2@%D\  |4|x 2O\ @ -)]`@ ^@@wz] O;$ (p,p\\ o \ @nv \@Y@" \@`$@\@@)\@[`  @Z? @H\ <G< \<to \@Z (@€ $H\`8 ?? @\]@Y d@ B`\@w"]\`8@\`H@^ [ " \@Y "` Y *?Y \@[h@o\`@?@@ "?\@`$G\@@)Xo\@,0 @m@o@f@ ``"O; $*0*\ \€ >!)!] o@fB@' Z Y@  Y @ ` Y *?Y  @^ !Z@@   ~t)p@"@ ^` Z[`` ^` ~t 2O^`( Z )p@$"@)p[@ @ rY r$ *)p[@ r[@s@%^ /;%p\@) !Цc]\@\ ZX`h@\@`%*\@@es@eqG@vo]o@/@@ H ™@ o8`/:h!wߖ !#?]'s' ,5Z7ߓ(p7 !we )` %c@c 3 ww]wwY`Z Y@ss] ^@] )a'] c M @  '_ X` hG][@_] c@u] o'@/@@ @ o8`/:!wߞ# ?!]'s' Z,57ߓ(p7 !'wߠ  )# %c@#  ww]ww^@Z ^`ss] [@] ^^` G0 ) w߀#@`?/:^@ zt'  (@ 뀢@ H^@[` w] @ "H^@oo  0/9@?w @ej (5 r " @K t ~@ _@dP_ t@h1@@dF_ot@_v P ] _ƀ p@_q ^F@Y@ƀ_ ?_ v`ht@ @&E oְ)!]@`@@u"]  @&6 @ @/Ѓ*0 ^ P@Z  € wwZ X`@ h    @&@   @&@@^ P ^  @^ Z X`@ @   @ @Kv v  Z PY@r@Y`r`Y`r`  @%ߞ@  @%ٞ@  @%Ӟ@  @%͞@@ )/9@!^ P@# )^ a]@ \ ZC[`@v @v \ ^@\@Fh]@tF o^ ] @ Gۊ ]@tF o )@ ^ P`~  ` @%h! @^ P ^  & @J& v @^ @ ^ P\ @:Y@Z@@  2@\ @cE@cCr\ Z X`0@o@/8  X@d9   `@  $vc8$ ]t t h  @o$ @%6v0^`^ t\@X`€F@F@??@^Y ` @ ? &@_t@/8 ^   )!Т`(@] @"@'\ \ *? ^ "@^ 0@ ^ Z[  "H#)^ h)^ (a]`4@@ F  0@s]o@ ^ ZX`€ "H\ h \`OF ]@s\ o@@^/8jY X__ @  `  @D `@2)^ @  \ "@ZZ ? ƀ  @c (r rr " t^^X  *@w@*@u@*̀(uh&Z ƀZ r\v\ov`Z @bdto^a]@`@F 8@s\]  @$p oר^ ^ (^ 0v v (ov 0@^ @v @bCX` ?@ )/74aЊ @]@ @ ]F F@s0F H ^[ X0 )/7ⴈa]`@A^\`##: ^@[`8  7@s@@#@^Z C z{d2O @ ^@^ HĀh@`G:`^@[@@ZoF HF`@r] o^`@ @@@ )/78aЊ P]@ 4@ ]  H  ^@[ X2"qBkc)0)pk@ &`H+@*#@ `Hh @rF`o @@j@aQ* 0`@ H` @Ē H `@``HՁ @@` H s` H  ?`0p 1@l@@ )/6D`]Y@ @j\@ \@k6` `@c/6؀@@d`8^ 0^`8 @``Hd$51`!+p% Z @8 $@bWt`]\A ``?`? "H`\`t @   t`@^`PH  w'$ $^ 8=! X^`P^ 8 r```T^ 8" `X# h]^ 8v`8 @ @/   `? `?@h  @Ւ  Z (tZ 0t\ 8t\ @t\ Ht \ Pt(\ Xt0^ 8\ @h  2H  $ @?h @  Z 8 D\ H =\ P 6\ X /t (t 0t 8t @t Ht Pt X^ 8t $ t@aV\ t H@aS\(t P@aP\0t X\ H"@ \ P"@  h S  @a>t 8 t @to$ (@`\ot (@`Xo\ X@`To\ P@`Po\ H@b  Z 8 3\ H ,\ P %\ X t (t 0t 8t @t Ht Pt X^ 8t @aXtt 8z \$ (@awt @$ 0$ o\ @`ot (@`o\ X@`o\ P@`o\ H''$ o)``?`?@O o\@Got #$@HA o8` H9 <`t @`G`4`3` **@ ` `H' <`t(@`5`4`1  *0,@` `H<`t0@`#4`o,ot @`“1  ov 0 ȝ@ )/5a܈`]Y@ P@i\@ \@ih>`@/5Gt ``]`Xr]v`8 @[ @  `?`?@h @ ? h@ { Z 8 <\ H 5\ P .\ X 't t (t 0t 8t @t Ht Pt X@`(^ t H@`%^ (t P@`"^ 0t X\ H@[ \ PX*^ hT t @o$ (@`ot 8@_3ot @_/o\ X@_+o\ P@_'o\ H@9 4 Z 8 -\ H &\ P \ X t t (t 0t 8t @t Ht Pt X@`1 t 8  $ (@`Q^  t @o$ 0@^ot @^o\ X@^o\ P@^o\ H@)/4 p] X@ ^  P`@D^ @` ^ ``P`d@^*?^  @ ~$H `  f|@& tX p]Y@"`^ ^ "^^q^*@p`Y@vY@*@p`v q@^  @A@F9 h] Y h8v @_ `oܰ@F,^ @4g^ @^ ")^^q^^ q \ 8 \ H \ P \ X @^yo@^uo@^qo\ X@^mo\ P@^io\ Hou@@ /3Ĉ`p]X@:\ "`\ @\*?\ h1"g\\ ")\\q\\ q \`8 \`H \`P \`X @^4o@^0o@^,o\`X@^(o\`P@^$o\`Hot@ )/3֮Ⰸ`]Y@Ā@@g\`p]X@"@ \\` `\@*\` \@gׁ\ "@(\p@\"\ 8\ q \ 8 \ H \ P \ X @]o@]o@]o\ X@]o\ P@]o\ Hot؇o^ 0a(`(t` t``@^`844 _<Y 0@=`t@ @HA`<@^\`\` *@<@ ɏ*2_@`$` $`@ @'` @ @ $`;`@)p\` `%@ O`+ `@@ ^ 8 `X^ 8h$h3 2O^ 8 '+ _^ 8@5 @^ 0/2G G  @|_  ' #  `x ? v]]@[G @]}@4B@y  /2L`]ߘ@^x ) !АGG@G]@ @@n+] @? h@0 /2ծ⴦w߀@'88`? @ @@@ `?@$# @ h @^)0  +p] ] +  @l @$#  @e $ @@D   !$ -p  *0^ X`h@ @+$ !)0.0D\F# @ g `@& 2`*^@Z ^@ @?`(E\ 0 (E(E +poD +0o$ hv@: ^ Z0€?ӈ$v@h&v@& @^ P/0ᜀ?`'\ 0"`)!]@`@F @k] @ڐ h`` `?`? "H  ?@ : @>p  !  )p?@$@c$%*$ ?@:  @>] "H``^` ! )a]@ GF oȂȒ! *p"H @ @E"@c$%+ @=" @ H " @C ".0`H( :` @| ?@! @>Z: ! *`H, ?"@ $@cz$%+0 @"@ h?G$@>A: hoܒ ^`)0ot @ $!   )p 6& @ov`*o\@^ P//߮ܒ?`\ 0"\ H)!]@`@ @- F @k] o \ H2[` @ @0 "*p`H( :` @ ?@! @=: ! )p`H ?"@ $@c$%*"@ h ?G$@=ڑ: hoܒ @^ P//ጀ` ^`0"^`H)!]@`@ @ړ F @j] o ^`HZ`@ @A"+p@ `H: :` @`?@! @=: ! )0@H4`?@ @b$%*p@ H( ! `+?@ &@ @=: h ?(E+0@`O! :`@ ooʒ `@ @ 2O`o"^ P/.!䀤?` \ 0)!]@`@D`@jX]  @l h"@  ?@:  @= '߀@'`` * 1`$`@@}w @Ґ "@r"j+w @U_Z8@'B H " @"\ H_ @*@C*0`H< :` @! ?@! @<: ! *p"HZ @ @b$%. @hM !  *?G$@<: hAj ?(E+`O! :`@ o oȒ  @ 2O o"'o  .oD"_+pot$!*po{\ ?@ : @ @W` @5> @W` @/> @W@)> @W@?g\ 0?(E)0@@W@ 2Hv v v th3t@Wo$@.  Oo@9   ofp@4H v: v\t^hto:   I"(E (p$v /ptt0(E^ P)p`H"*0%  ߺ f@ @^1E@^] wߔ?]  w@Wv@Wr@W@`HD"`>` @^ @'%@ @ %@?"`@] 0 6 @ `?`?@@h+   h& #E @^ H o%@@W @?@Wo"g@] 0Ӏ?o 9 o @^ ")0\`P/,t0@&@)a]  ЀFg@X: @:! @ &`O򀢀# hB&@V @4@V` @.@V @(@V @"@V`@ ?"g^ 0"?&h @V&&@D`@gh] ^ h    2Oo0#@/+pr" @ 4Oh )] @@ /+`w] Hww_$Y 8@: @^ P/+Ǯ|?`\ 0 )!]@`@  @F @f] o  +pƀ @?`(E\ 0 @(E(E )poD .po$ Z P?` Y 0 @$*0AZ P` [`0 $")p*0[@[@" y(Z PY`(r@Y`0r`Y`8r`@ )/+l!^ ^ P  ] `@ ZZ@Dv @v ^@[@Dh]@fF o^ @^ ^ P @?\`H[ 8`@ *@ Z X`8@D@@Ux@UvX@Y @D@o@/*@H @>@UI@UF@UC`2 @V~ ;@%`] @U,$8] Zƀ@U,@  @U5^Ht@@U8vH@Rdh`?@zo `@U ]o$@U @U oȐ`@Q o@ $/*␈a8]Y@@D'8]\@+%@]^ @@\f"] #0a]  ]@T\@ @ \@! @T] H@@ΐv@] ^ @8]h\!!] @ @T@t0@] ot@y'o /@@@/*02  ?a!@@@T@T`@N@TJ?@`..@Tha(o]]@T)@a @T] o@ @T` H: \ ^`@@ @TT@   8`@@T"@v N@ @hv @hv o. v@ ڒ ^ @t @ ^  @T8@o@^    @TR @ \ ?  0/)⸒ aH@`]_@ @X`_^r v@^@| "Z " Z*  ƀ @TG@ H ʔho~: 0/) h@I v`aH]@`B_@ @SX`^`_r v`_ 0/)@H aH@`&]_ ƀ@k0/)ؒ .@ v`aH]@`_@X``Y ?^`q@Gv`_  @@@  @ @S @ ^ ? h @So @^Z  @Ԓ  @  ~4~t@ h~$`@Sh  @  ^@ ~tO`o @  ^ @^` @ ^^@o~4@  ~4~t@ h#~$`@SB  @ ^@ ~tO`o @ ^ "^ ^`@  ^ @V^` @ ^^@o~4 @^ ^ @R ?h@uo0wt^ ?_@ #/(ᜈb@@_]`?@ #/(hb@]@`0/(D^ waH]@_O_0 /(aH]@_n_^_v0 /(saH]@__@  ~$~d@H)^@@& $ @^@ `@R "@\@\\ ^o^@^@th v@tt@tot@o@  ~$~d@@  Z    0wwwwww q_@€`k_@ `_@ ?`_㾐 ? ~$xdH N `2H^h@   z~d@H9 Os  P  @p ^  ^ ?@v@Qڐh8`  Ps  @W@ @R@g@Qo^@ ?  `@Q@㾐O/'\s  P  @, `    Ps@! : aP]@T:@` @Qh@Lo@ '/'ͮई`]@]ڕ `  ?y$d@~/'`@H`N`@`"H.h @Q^ d%@ ?@耧`@^ m `w _)w!!hap_Ϭ!!!? wwwwww@@T `@@`r H_@Q&'x  0`@R@ @Q<`` `@QE]o@Q%@@`"@=_@Q"`2H ^N "@^ N2O ^" @`@!_`H `N"@  N2O  ?@ `"@5h}8@P]`Hv&@ht8@P]o^]@PŔo@Pɐ%@`2O^_ǔ@P] o@P%@ `O__]  @P] o @H@PH#L`""@L%@@`"@@Po`_]@Po O%@%@`O_o%@?`O_o!X] @Pj `2O^N"G^ N`2O o^@@P]   i@ @ @ N @H \ H ) <`h 9`, (@ `) 9` @(`) :` d`H`\  , N  @  $O,: ,$ @S@) `OϢh, of` ``Gٗ) ` `2O`oҗ) ,㾠 $/%⨈a8]Y@Āy\@Y#a] @: @6O @g_ϖ!] Y` "`\Y@'] &@: @5O @K _ϔa] Y`@"`@Y@a]]? @$@@|3aа]!!@Pf[@ H!$@: @Ph$@aВ!]!^@@PX] H&@: @PY?h*&@: @5] H"oF@: a@5] 6OaoD@_O 2o@P]]?>` @@]$3aа] !!@O\ H!$: @O$aВ!]!^@@O͠] H&: @O?h*&: @5:] H"oF: a@50] 6OaoD_O 2o@ODo_O 2o%@ODo%@so@X\`㾠 $/$Ta8]Y@Ā\@Xr#a] @: @4O @o_ϖ!] Y` "`dY@'] &@: @4O @S _ϒa] Y`"`HY@a]]? @@]$@)!а] !!@OR[ H*$@: @OT$@!В!]!]@OD] H$: @OE?$@X\0^ [ h*d`: @4] OoD: a@4] 6Oא!oD@_O 2o@ODo_O 2o'@ODo'@sbo@@Q@N?@ &  H! @Oh&@N O?G9 @N&@Q̐: ?G@No@Nr> "㾠 $/#4a8]Y@ @] @W+a] @: @42O @_ϖ!] Y` "`Y@-] @: @4O @ _Ϻ!]Y`"`Y@a!aؖa]]] ?!]] $# /@M԰ a@z]-@Nc?@Nv"@Mʢ*` , @yL "@, o?L `@ 9`@y "@ o ) :  #Gސ@Tݐ#!a][@NK!a؀ ] H$$: @NKaЖ?$!]![@N;] H $: @N<?$@Ww] h*;: a@3] OoD: @3] OݦaoD_O@2o@NDo|_O 2oe-@NDoa-@r_ oE@ @ 2`@9`N1 @ @ $@`$O @ @ h< @2`@9`N< 1 @ @ $@ ? @$O@ odo@ e 6N@NS0`  } *pI@j 1 @ͷe  @ r " " r rtZ "@ ^Y @@M @M^oq@@^  @@7) ^]@H ^  44L@1 @N9^ `ƀ8$h6&4 "@^ `L@$J2 2`@No@ 6O`oL@ $@3`k  @4  J ^2`@NX@^@LY@^qo& @^ @^HY'@ ^ K @7`@O0`@M@^ ^@Y\ $ :@ 5 @L @  O   ~~4@H5 \[& j@ h & O o 45 o@@uh H6@u@L /@u @' @uw*`() `@#8`@O9 @  `)``O8`h@ON "O @M o.@Lu /o٠@Lq :oؠ /@@@/!␀@`@L\@w ) `@ 8`.@@^` @) `O`@`.@N@@"@H.@L`@`J@@@  `"@ "@`J@@@`2O`"@ "`(N@ "`N@J@2O`N Hea!]] @K .2OJ@N``.2OJ@@`N@O@@Koߒ .Oڀ @Koӈ @gN@"O.@oLJ@O @@G`J@O @o) N @ \) :  /"@.@`N@`O@@KhI?`""@)?@t "Oo @tϐ H@tc ?e /@@@/ Hƀ/%)]@`@|N`/@u/@f@tY @[>N"@J@K :6N  :"@J ] @H "@\2]h@G`/G`"O@LN@LN2O@ @K@K)]`@K%oӐ!? #@Ja]@Ko?? :*  *@Joob] @ @J /o /@[]oN@&?*0 /@w@JK`/Ol%)@J gg%)@Joa,?)]@`@ !@[] h@K /@@@ @ ~txt/ ༀH .@ @\`b @J] @.@h@JkI?`M?*` L` ?*` L@2o?*h L`  \  y$|$@ @"@JC ` @K`O.@@o,@J{  hG"@J /? L@` ) OoܠL "Oؠo) ?o @s< O@s @@s @ @J @` @Jh@s ?J `Oo@I  @K6 ?r  /@@@ @ ~txt/ޮH .@ @\`ga @I] @ /.`.@h~@IK??@?dP *` J` ?*` J2o?*h J@`\ \  zdz$@ 2@gҐ" ;``: @Jo.@@IӰ  hC" @h> @Ih: @I :? J` )  OoאJ "OӐo) @r O@rِ @@rԐ O /@rh"? /J `O /o@IP  @Jl6 ov  /@@@`\@& ) `"@3< 8`"@N ) `\@ :  ) `O8`h"< `/2O N \o@`"O) o @r< "O@r H  @rJ  O̠  @ /⨈a ]@I H @HI?@@.) @@H ` I?@H ?  `,H@O?: @/Ѯ> a @H]F`@ @H(@`O`(@@/p`/@@q a`H @H] HL@ :@H h N@@  @L/@@@Hˠ?`@G>`>``@ @ @ @H@L@H"@/,@b[? / c @Hs] @D #@Hz]>`@K?`.3 c0!]8 @HX] H) `Ha)!]@ @@@YB]h$?a] `@H@Y6]h)] `@o#(@H;@Hp .*?>`oc  @ /␈c]Y@@ /lc`]Y@@ /Hc]Y@ @@HL`?@/r@!)!]`@c]@U#b]@X!] `@ #]\ @b]@X] c`] \ 5#c]\@ ,  b@JS]@Ht @H\'t@a] h"&@JA '@H}t@']\?"` h t@Go @Go̞co] @ '/X#b]]  \  \@GY@H  " @ h ]\Ŗ  \@GA@H O @ '/ήt#b]]  \  \@G @Hd  "Ѐ @ h ]\  \@G@HL O @ '/␐#b]]  k\  e\@F@H+  " @ h ]\S  M\@F@H O @ '/\ᬐ#b]]  2\  ,\@F@G  " @ h ]\  \@F@Gڐ O @ /$̈c] @!#p] @P ^^#x] `H $h$#p@O]  o&@PXD #h ] (p b]@FQ@3 '/#b ]]^@ē @3 '/ޮ㴰#b ]]^@ @3 '/Ϯx#b ]]^@ (@*0>`@ /c0 @H]: cP@F/] H2X @F'] H*)#]@F@Fd .  b`@F] HO' . j a _ J P,` E U C,@,`,`,`,`,`,`,`,` @FD .']\ .#]@Ft@F6 .**Ābx @E] @ — @E] H \@E] ]\ ht@Eht@Eoӊ#h]@E @bp @E] O' j s a _ J P . i,`,`,`,`,`,`,`,` ,` ,@o,` bX @E]o'b @E] H##b ]@E  H#'( @E] H # "0 @Ex] H # j] a _ J P . E U C*@*`*`*`*`*`*`*`*`*` "8 @EZ] 2H# 8] f r _ F R . 5 9 - 1*@*`*`*`*`*`*`*`*` *` *` *` *`b@ @E7] H# 8]  d e _ D E . 5 9 - 1********* * * * *H @E] @ "P @E ] H ##"X ]@EZ] # .@EF]o0/!#] #'"] !s]w]  *??1@+!c]u@@q> 8 (~dHd ]c.@w  #wߺcظ @RL!`7_]@h.@` $` ]] .@@ o` .@@` @ _@@.o_]] Z@Y@ 6oТ  cȈ]q@3*oƢ  ]??1  㘞!] u@"@@ ?2o]@> @/hc]]`@z!#]]\[ hc  #c]] @`@@_" .?9`sc] `@ #Ф#]] !"t##?] &@`@^$1#] @4H$D] @Dm\\Dt+`㨦"]&@$㨔#]] @@;` `<@?  ; "H   @?, `< !; # @]@ @"@ + ;`h] Zos#]]@@O#]] [X@o1ov@/ `c]\cv] c^  ]@p]hv]@p]otv@@ /֮`]\ @ t`]\@ @Jht@Jot@? )0/@  `@DR @@??G]4  @,  `?+?`O o@ `@&`] 4 , @4`.0`@O8 &@"0w/ @+1 ] 1`@)``)0@?7`/`.p @ @0``(`  /0@ @ 0`(`   (p@@ 1`@ ` .)`@ @0`(` `  (p @@1`@ ` /0)`@ @0`(` `  (p @@1`@ ` /p)`@ @(`0` `  (p @@ (`0`` )0@ @(`0``  (p@ '@0`(` '` )0@@1`@)` .@@(`0` `)0@(`0` `)0@1`)`@ /0@0`(` .@0`(` .@0`(`  )0@@0`(`/0@@0`(`/p@@0`(``/0@@0`(`@ )0@@0`(`@ )0@0`(`@ )0@0`(`@ )0@0`(`@ )0@0`(`@ )0@0`(`)0@0`(`)0@0`(`@  .@O܊@  @1 ]1` )` .p?@O_'@@/r@`]`1`@)`(p6p @8& +)/tߠa]??@t?+r @ @%?   @kp@ #`  h]] X@ /qO a ]  #@@A"? 7 e0"[)p?׶  @e0@Hp@ e0 gp@H=?``8h, h) ` װ^?*  1,p?` `Y@w ΀ 4 ?  ۀ4*@*` oӔ  ?Ϟ@s  `*0(p  ! ˱*@ #@ +0?ӈ@! "  )0 @ *0# )0!@ 20  !א@)0*Z@ .0 Z @5 `  o.0(o? 10*+@  ,p[w `  ,p?@^w@ `` ,p` `[@or ?ӊ @@  !@?@oÀo  ?ϊ @O   ?ˊ @O   @O   @Oܘ   @O֘   @OИ   @Oʘ   @OĘ   @O   @O   @O   @O   @O   @O   @O   @O    od@ ? ŀ`4 *4`*@4  dP h-"9?߲ @ t@@D h # `ho]ߺ[@ @)/`a?]@/p ?  @Ԥ #`  h] ] X@ /qO a ] #@@@l` e0? *gpH?`c@@"``@ g0@`??"`P$ "@x @ @` @*  `*Z  ,  .  + `  @,`o @ "@` @ `/0.0 `@ @-p/0&.p+'.0&@10 /0@.0 ``r @*r ??o4$`W@ o@hR$ N@? hJ`@`-p/0` +@)0'.0@)0'.0%@10!.0@-p or`,``o̠ ? ? (p.p @  .p)0"@*@/0#)0"@2 a/0@+or @ *poX#h o=]   N @hZ @ko@@I @ <  @@M @?^  hH"@@@  /@?r /@lB,>`@,o @lD?2O,@?= `H@kV@@?@<  @  @>=`@?%h">`@l"?O@? o@? o ~)?@/ᬠ @& Ha  <  @@@& @hS@>'c (] B] Z@ !(@ܐ o@k!? 0$@F9  /@>w]L  .@oL `O`.OL `Oo@?@k "H@>1'+#`8]B]\@ o!) /%@k!   @ H@@E  @>X]  O@>Q] O@@? h|$  @j@?Eo @  <  @@  @'/Ԉ]@`H' c]<`(p@@>``Ot ] "@ $/ݮ\a8]Y@> )p H(p#*@ <@=& 8v hv @bo> jc )p9`#@j` )0+p@  (p"@ " 9`9  @9@@www@b_`Hƀ @=_`H>`? j>`.pk !/0.+p" # 9`9 @_`Hh@>Ӱ ?w`H"qB)pj@Y ͞@@ $/qଈa8]Y@@bL8 @:;c?]` _`H͚ > *p )p# + Hĥ.  @@H`>*0[`[`*0Z h@_Q>@ H H "@ h h G4Ooc!]]@>$ w%u @qu n r o U k  e* ** * * * * * * * * * *  *  ] <`*p@ @=`` Ota]c] ] $    '!c]`P] ]  b] ]]  "`@7'""@*# @ $(@$`2Occ-(] ݒ oYc   ] Ԗo$ " ]˘o$( b]  ˜o#  ]o"@ao). `d@ .`- !!@*`+ ,`/`~u`8%`0`0@ $/ÿa8]Y@"q(p;`j `H  ;,@)p$,p 8 H < )!]H  ']`"H/HU`/;`k#k *@ #`@?0`᠉*0% \%'P] ]\ !@ ] "p] [ !^ @Lthk] h]\@! ^ @Leh\%' "X]  ] [oՔ!%' b`]][ o˔!@?@:j#b8:*l " )0+p@@ ,$ " :`9`]@;o@:jcbH<,j #@)0*@ +p" "@<;<]@;̐o{:"@]@;Ðor:ob0@`oB@"qF)0^ j@^ @;t @  ~$~t@H&@hv`@ ^  h&@@<{ov`@^ @;v @/h@`H ) Z (@ !]  @"x@L]@;|\ (Ò@ ^  "qF)0j@@;h^ v @/;@`<\`@ @@p@ h6t`@@;<@;9 )!Ј` (h ]@ H#@LF]h  @;&\`@@;# @<_)b!  ]@; \`@@;)\`@ht`@]]@=! @/@_բ b \ @ `?yt?? @ "?@ ?3]h/] @:\ @t @@/Ϯ$ @6 1.!%^@ '3#a] ]_@ D7' a]]^ o ';#a ]]^@ o 7' a(]]_@ o?5'3oa07 '8#]]^@o '1c!@]]^ oʴ '3#aH] ^]o 7';aP]]^ o ' #aX]]^@o 1'5#`] ]o_@ '7#h]]_@ o 3' cap]]^ o ';#ax] ]^o 7'1!]]^@o 5 '#]]_@ os '3ca] ] oi_@ '7#]]^ o_ 1';#a]]^@oj '5#] ^@oa]7' a]]_@ oC '3#a]]^ o9 1';#a] ^]o/ '7#]]^@o: 5 'вc]]_@ o '3#a] ]o 7'1!]]^ o  ';#a]]^@o  Hp Dh,T|<`ԝ@/|؀ @E6 1 .#%^@ '3#b] ]_@ 7' b]]^ o ';#b]]^@ o 1'5#] ^@o]7 '؊#]]_@ oٴ 3 'bc]]^ oϴ ';#b] ]^oŴ 7'1"]]^@oд 5 '#]]_@ o '3cc] ] o_@ '7#X]]^ o 1';#``]]^@o '5#h]o 7' `p]]_@ o '3#`x]]^ oz 1';#`] ^]op '7#]]^@o{ 5 'c]]_@ o] '3#`] ]o 7'1 ]]^ oJ ';#`]]^@oU '5c] ]oL^@7 '#]]_@ o. 1'3#`]]^ o$ ';#`] ^]o 7' `]]^@o% 5 'ذ#]]_@ o 1'3#`] ]_@o '7#]]^ o ';c`]]^@o '5#]o 7'1!]]_@ oٴ '3#a]]^ oϴ ߁ 4\ Dl$Lt 0T|@hЁ@/ @Ge cX ] t)]@`@# @I] h@7@7ސ@ 3@(hL1)!]`G >#(\]@Hhv/@o\c0] /@7뺐-)@d  H0]`@Q c`] Y@# +3cXc@] 8^]@]@7`딒 @d @0`@(,p^*^HЦ]@ @-h*H@H]h#] 4@@7~h#P@H] o@H]oك,poڦ #8@Hw] o@7go@  ~$~d@@?/ 9` *@./``H$ @ / 9 `H/`/` @x ? `/@`\@`?@ `[@ `]@@Oڰ hf@f ha 2O/ h] "`WNN *@J)  HA)`)` HM )  @o)` @o `N /GӰN`*Gπ`\G̀`?Gˀ`[Gɀ`]Gǀ@Gǀ`oo h ` / 9`/G:oh `H oøN`*Oo)  .O @  @* @ <``.`/*`?;  `?`*@`*H.`[`""@H`'`@ @ @   o޲`H ,`??hd@ O@ O@ ,; 8`@`?`?@G‡` od@ @3`[H`\`?O؀@ ,;` ' " `?`?Ò@ Oʀ@ `@g "OȰ hbO@ ,9`'"`? `?O@ `@R G@  o,;` ' " `?`?O@ O@ @; `@8@8:` :Oh0,;`'`" `? `?O@ O@ N  *@@  < W @ `@` OO h N h `? N *"O o怢@N `!  `?6 N`@3?`\@(`]`?@2@&N  -@ @"G o N   @? \"@   ``@O߰  @o۷fo H >`h  `H@d`o̺`?㾐;/ \ch&]Y@ AA-#px] @b] 5wwwwwwwwGc@9M @/G O____wwwww ( @jX@js_t @jp_t @jm_t_ @ ]@jft @j( r \rr ot@<@ 1 @}x]@C]T_GO@7wWwowgw_wO^ Z@9wW`@\\  @!@4Ho^ @Y+oԠ@ / t@c]\ @\`] \ @Zh \@4S  @ \*?\h  \\`@7֠   \*?\o@ / ℈c/]@  N /@  f` H_>@3?`%J?`/@^%@ @@4: `@<> @ <@#(@3#@ @3 @'~@9<- /@4#@`$I `@`.@>@v)@4 @ >` f` O />7@h Ho>)?g%I/"O)o@3h o~f / c$@3i  H!>@?@3 `@!? ?/@3< @`H /"@,@<?    `?`@ H@/ @ @3 /*@`F` @ N )a]`@! ]@D )a]@`@6 H 7 7 @`# @)7  "H ;c ]@3 2@h@3 h] `$G @3!B@Tβ#@C]oڦ  @C] oʀ)@2@2 :@h))] @!#]@CÔ /o # ]@2 @@2ɒo@2Őo+)a]@ $@X @2#B@T`@C]hM 1?@2o@_ Go ?y )] @ G@C]oi @g-L@`/"O,@o(<))!]`G-@Ch]h )Ђ#] @ Oh  !>@o?~'!NJ>/.P#v@~s@@>9u@ Z>)cȬ>u!\>cК@>s@ Z>7c؈@ ϸoq@ܐ @2m/@z< @( @!`@^` /@Y;,M`/@$@@2V z$@6``.@1`O̒`@-)]@`@ hY #@B]hS @1;)aи Z"]@$@I @17B@S]@B h=@1,` N)"!] @2 @1@SB@^@B]h#;)a]@`$@ @1!@S|B>@\@o]5)]`$@  @1@SjB o>/ ww  @3  ?@%wߐ`w]@ @z+``] ] E@$@f! = t)=@2Ȑ @Z!'߀`@_)`@ =`@ `4O H & && & @1/_@1Őhe' ' ' ' ' ' ' @2'ۀ @ϐ  "O֠  `Oш  @   ' ' ' o' & &  &  o& ]@1u o#8]] !P\@1ho 0$@@,]  `]@0*0@@H$$@``] ] D109`",pon$ `(@1F]%/HP`w]w@߀ @)` ] ] %E@ $@ev t]\@v  @2: ??@?: @2 @߰ `@_% `@6`O @0_@1 @zH]@@"+ `P]]<`Z@*p5@@``2``2``2``2`` 2` ` 2` `2`@O<`H] hP$@' ' ' ' ' ' ' @1'ۀ O`ϑ> `O*0]@ 2  2 2 2 2 2  2  o29 @d ozt0$@@, ]   @0%] *0@H%@$@` ] ]C10<`$+poO#: 0/H @) 5 @X]_ @  Owh<  @ >@/ O_o  @@ 2O o$@`X]@@OӘ  㺀3&%/X`c] ]??"@"_ ';  ] Ș  `14 $c<0@@`c@@f@?`6  # @/,0,`  ?2# ?@/<`(p@ `?+> a] #?Q@ @c]@@S`@MaH "9`aP]K  :@ < a@]S @@ `]R@ @ʀ1< !]R @ $@;`+0 ';? 3@1 .0%Z@@  a]@`!@): !] *p R$!`]@ ` ; $$ST :H )> ]S @+  x] oXRЊa0]oTS@ oЂ o͂poʂ!oǂa#oĂaxa]`"H ap]`H!]`Ha]o"@i7H#!a+]` ]"#Dai`da$]D l d]@ !@ ]+0  %@*&$o$@9`!@]ov+ a ]]]#"%a]or"! 1] $@!]]"@ ob##`]%] %@]oR+!` ] !H!@!a!!]]]   "@%@"]o9! +]a#@] #1$a!] ]# o$#@ +]a#@] #$a]%aob ]a"]1 $@!!ȘH]] ] #  %@"$a]o% # haH]] "@oĈ   haH] ]$o  #!aH] ] `od`ᘒ h]] @) !H @]  o!@)!+]aH`h] ]&o~ 1 hH]  ]#o#@(`!a-`] o߂@):!k d, "@-`*@]. " o0!1!h ]!!@] o)!h ]!%@] o ah] !@]oa1]o!8a)]!8"@]! @o !oo#a]!8#@] ooDDJ  -0"@](p[ o@sD)(p "@]*D[@L@o2s@`I ]; [@o's@o#D`]Y@ oq@  ] =`Y@o D.0`#] o-0D#`)p] `&Z] -0@`or!Do؈ ) ]]@`ou@! ] Z][@  or D]r@]`@Z;`a] E@l J $ #@<`1r!8 o]N @)9  +] `t]L@ `GZoܛ9`h˰ a@D] ]"Y@.0r@m D@)p",p.0#@m +0 L" ax].0] \@ @ah@]t$@o"H@`G)!@] 9`u@]"[@)0m@L @:+0(p& "@+p!)0m@ !@M] .0["@ o@>%@4c a]?Q@ @   :@ < !@]U @goTa0]R &@ O E@ $h] o$hD O瀤o ] @Gp?o!@!(]]@#o0]U @ ?G EGc]@ H$?!@h] fos$2OԠ o$@o @$@o%  @]d(4@LX|dp8@ 8t?` @;?: 9`j :@@+0":(p!@+p )0"*h)@H'? @$: :(p9`"@*+p# )ph@ ` @?: :k` 9`@*0#@; (p")p" *)0#@+0 5 $/ㄈah]wǸ\@W_J@ 2H\]\@J< @,[ @Ś - + `?`?@ @T@-ϰ @!․ (@ [@ (`s@=` @ ) (@A`4O[@o\o`\@N@`> ht@\I  <`@-t H`.@:o\.o ].\@t!@h}9 \H@`+@`-`O!hst`o! `?`?@ H6 0\ -?tK@+f` @'$]ah] "@_]\@N< @+t@ @ $.`@o$9$!h\] tI@!!h]h9$Sh5"@\@oը I xOѨ -$ ht@]]%]Z@`?з, ? > rH к?``H`@@+ o"@?!hro + o+to/@*^) `@8`9 @-,  @,@ )``O8`,@*6 ` @*1 `Or ] \@ pOoI @ `\@*?I ذ!@*W] @@ ! @*P @#`]\@ @a! p] \@ @*q "@.1$`\@*\@@)Jos@3`]\@*"\@Op2@l!@,Oo "Hg!]\@"a!OoI"@1$`\@  hV!` !h]#@hPD`@*: G1$`\@*\@oOp@) p.?]\@ @? so,\@@*" G1$`\@*?\@o s\@@* G1$`\@*?\@o!  "HL?"g1$L? "G1$ +*@ O oj` .2OZ /roW @-XNoA,@0@_@t  @n@0/H@_@c_"@8Q 20 @ dyd@HHД @P] 〣`H "+0l@ )p"(p&+$@ @ _"h. H+#"+pl@ )p"@(p"*$@"Qnn @)p#(p"@*& "Qqj @ @ +"@*" .0"*Q30 h@@A@)/J☊ ?] @)w_w w@0p!] @`@y)aX!]1Z@2m!']_t@*#! a]  &]! ]`]`p]!]a@x]-)] 8+] ]`; ]a`]] %] s]s$t!w@&@&&'&_u@] +$`h@ O] l<H$@ <$@-;H`aȨ]]]]]   "#@$@$$ @5 `f f f `@f@  f`@ H@H `H_a] H _@]Y@@`5w_@_!]"@)!X]@2^h_5]`@!!p]H'%] @H')!]  H 1x]@ H+_'1975Њ!8!!HaȐ`h] ] ]] ] ]]]]D@D@@EDDFGFsss@?g`]\&@@@?g@ ][  ?g@_@ h ]Z&_g]H 5!!p] @@5_x ]@ @ @ d@@5] @#a9] ^ `)p]] !]^\@*pZt@o_v!!]Z.0#@-@&@?gC@`]\  ?g:@dpo6w@4?   @)`8:l EdO  ?? +pg@ $  `d EH< '% 耦`]H ; k`d/p.#@ 2H  ka@)0,0#@ 2H< <`]*0"`hC@ Cf ]C@@  :`:ss@s@o? Ǥ'lořd !h]] @X $@  9``?n` +`?#&@:  @ -0$(p!.0H@ 9!x]d<,0)p&+p" +@ )N=@|?g@o 5@!   40?)`8@ :j Ed@ O ??` g@ ,  "d  EH< '% 耦`]H ; k`d)0.#@ 2H  ka..p#@ 2H: :`]*0`h$ ] B?CCC@ f :`sss@:@o? Ǡ'lořd aX!@@/] o@/(G?? )0 d"@EH)`Д`耢] H >i`d@  )0 /p!@`2H  ia@)0+p!@ `H   ? >`  g {@ @ "`> ]+0@@H? h?Q 3 @ht @@@` T>N D@? @ ;  ]; *p A@ O@'@ @ aman` f@ O @@+&+0" .p@?@ @h@ - "Hzoq O   d`EH$`NJgК` ``H] 9`k`d@./0#@`2H  ka@./0#@`2H "o gloދd6o`@ "o+0 @  `> ] )p@ ?o d`EH# gЖ` `] `H 9`k`d@/p+#@ 2H  ka@)0@.#@ 2H o"`ǔgloދd NJlod @88  zy$@ @4?@ @/` ;j`@  *@ "@$  ;j`  *0"@  `?`?@H   $$@9 *" *p .ph @`? `?@of`@@( : @'/]`H a ] `@(֑: ` `.@O ` ] "ĀL`H !!]. ! *  + O@ d`2 @ /b@]@@ $/̈a8]Y@@6  b@$] @h/ @ d@.C\`@]\0@@Z \@ {$@.\` @h= @`o@.\`@2@.!\`ot0@Ioʢ@ $/จa8]Y@@( @ )@.\`b@]\0@@Z @%YZ  h@.L\`@2i@-\`ot0@ISoآ@.?\`@ $/rЈa8]Y@@ @ @-\`b@]] 0 @@.%\`@2B@-\`hu 0@I,o@|z4\`@.<@@$   N .Ѐ `@  `  g @@; @*oNh: :@ $/'⤈a8]Y@@E`F   |~t@H@$+ H9@ @-t\`@] ^ 0@!@.  \  #`@%\ #   |4z4H \ Z  fp\`@-> h@-\`@1@-H\`ov 0@Ho@!/ӮT"@]Z @ X` @h@' "@b@#] @"@]hZ"@] @"Z @ h@ "  `H 㾰/'{ @ N@ @.@'sN@`?H 's^ 0sB Z ]@#А@$,-0 @#a\@\` @Ł  D`\`@a{A s2@v { @$W4 ā  ``_@@, ""wwgw_? @w )`= 'w+0 `, `, `,w@#*p @$ Ft ?  @5 ^ ? @@D@B"@ wl@ hʐ s`H + b]w׹= /0Ϩu?@” ?s2Hv hJ@@@h ^? P>)@#ZsH@ @ @ @"ʐo@"\__@#] ot!] @`G_g\]@3o .@#\@*\@@J@`@(\@@o\`  )!]@]`"@3] .,@?=)!] `G6Z @3] o1{@Ð?ؒZ  @o .)] @ @ s H^ 0@3k] s, H^ 0   @ h@#.@" .**@0E@" .**@"o@"C`?o@ $/L8a8]Y@@4   |$~d@H1 @"R H+ @ @+\`] @,"\`Z 4h\`@"" \`Z 4h\`\Z  {d\`@+۱<h@Fo̢@ $/(a8]Y@ @ @+d\ !@] Z @ hZ @"Z  3h@Fo@+\ @ /׮da]@z@ $/ͮ<a8]Y@@++\ !@] \ @+@Fo@ $/Ȉa8]Y@ @F~@+ ^ ^ ] @+e`(@ $/ha8]Y@ @Ff@*\ ] " (@+M\ @ $/a8]Y@@!@*\`!?] `( @ 0p!@h.@FAo!]  @  \`@+#~t@1^.  @@ \`Y @!@!8\ @O ^  \\  @ @!+ @!'^v 0vv v v v h v (@!o@!o0F '@&^@Z` Y  `@q !  `" q  0F '@^@  ~~$@ ^@ @&@3  : <`&*p^@ \ @ @ &@`O&@  'w@ wF ^Ж"F   HF ^Ŗ27   @  Z v` ߐ@k @c h)h" h 7 @ oٔ@  Gې@o@^ % @ ,>  @ ",0^8`@)0@!`,0^t  `# H& ^` $`@^`h & >^@,0Y @ eY@ $G oش@^`@Y  ƀ @k"^^@a@^*?^h@^t@ ?  ' @ t  ? o  0F '^ \ `` @^` h@Z^`   Gt6 `@ @`2Hr`  " r` "`r`r`@ @Y  "@ c@1 $ @(@@ `H d4 @  & h v ē < ^)0@"40`?F  $+: +0@Z@ o& @+ h@& $o  @^  ( Y v t @ W~ tt $ t h \`t ht`@ y ?@^@kX@h`@   Hb@w  `? @ `cf@HU@^ d\@" @` @ Z`^  "` \ "@\Z` `4\@ &O`@E   $@`cH( d^"@\*@ @8 @O`@  Z`^  "` \  @ \ @&O`oo\@&^  \ ? 0`@ \@6` @ t@>` `@ +\ \*? &@^ @ʁ@\ \ ?o@ Z  ^@ݒ @^ *?^@#/b8]`H)8`] @`"(@] @@H$$b8]hD" @t] ?@@O$o0/  w@   @n0`y @ )!дb0_`@ Ow"~hd_ o  β GZ \  \ ?   @;3`4\\ 't@@\@ ע @ S@! ?_o_ ?`,0 @ӫ>`@-pw@o` % o@\ t@\ ?`ot@  o]@ &G_ @* @.]o_  @`"@?  ^ @ \@ "@\  $@tt@ O`!@`@& h%=  #o& ` "Gꀥ \  t tt t t ^ t v ^ "@t@"`v t@o @ot `Oˆ @) `@8`@ j9 @  )``O8`h@!MNo.@) `@8`@!9 @  )``O8`h@SNo.0/@@_ `)" ]f`Y@'/㨊b `"H]].Yh @^ 0?2p!/ԮP r e`%@u@+|ې `bH`@ +;`sj`< /< ]k <) !@.`$;@9 h o - f o v.@.`.`.`.`.`.`.`p/h@W H))!]@`@P@-] h`] @ ?#bX@-]?4!"`B r@1'#] b`Z@]  !1/ +"X@H"Xh]@He &@ -: !k`<"H:#j<] , ]") Z@" ! /< > s@ho  e f o v.@.`.`.`.`.`.`o.`0 r# eh?10!?2! ` w@ L @hh.` f o v.@.`.`.`.`.`.`.`0?/؉2p! r e`w@ 1p"X@H}]$.@h  f o v.@.`.`.`.`.`.`.` @ '/8# ]"x` f` @  @ @  @VO` 6 |4@HH@h@D` G耦 @>  G !\j]o۠:   @ݞ@@/(@HC c]Y@(Y)] `@>`6h: #(@,] o>` )!]`@>`6@_h : #0@,]o>`@ o٠@/îD@H  c]Y@&Y )] `@6`h: #8@,] o6` )!]`@6`@h : #@@,]o6`@ o۠@ /dc ]Y@Y 8) !]`HH@,v]h> ]@ @cP> >@@,h]o> @o> > /Z@G c]Y@FY (")] `@π H;: ______v`v`0v@v`v`v` _h,v`(#X@,/] o)] @`@@Go@_ H: _g____o_w_v`v`0v@v`v`v` o_c`@,] o@^ o /@c]Y@EY 0")] `@> π H:: ______v`v`0v@v`v`v` _h+v`(#h@+] o> )] @`@> @’_ H: _g____o_w_v`v`0v@v`v`v` o_cp@+] o> @  o@ /c ]Y@Y @) !]`H@+]h> ]@ @b> @ @+]o> @o> /4@FƐ c]Y@3Y )] `@o H';`@)h""@+]] oo )!]@ @F@\ H8`@h "@+F]o@ oΠ/;$@F c]Y@2Y )] `@o H&;`@h!"@+] oo )!]@ @G/ H8`@Uh "@+]o@S oϠ /c]Y@6Y o  @)] `@ >  H&;`@h!"@*] o> )!]@ > @Ē H8`@h "@*]o> @ oˠZ (Z Z hr r r @%/]Y@<`)phd^1#x]]@? tbȐ?@]t А?@] t "ؐ?@] t b?@] t b?@]t (?@] t 0"?@] t 8c?@] t @\ )\ 8@))a] `@ #x] ]<`v+ph\#]@*K]o]@ $OocZ (r`Z hr`Z r`@@@// ^v@ &` &` &` &`^ v` ^ 0v`0^ @v`@^ Pv`P `&``;` `p``O* p ( @0? ,`&@2 0`v`( h %? l`&@30 0`v`h " ? 1p #v`]@ H1'# ]  Z] H @) h&@hv`o30 o׃2 0@R?_2! @ y$!@t0w@'@0w@'@@8`?? 10!y$?0p ?0p!0p `" ?dg2 8?0p!2 @ `?yd@ @@ {d"@?ch2 ?10!2 ?1p!1pdP@fP @` @?f@ /c]Y@ @ /㨈c]q@@ѐ  @! `< @ @@@Eh!H @E? @@EZ h f@Y? h"@ dg㾠O̔ @ /┈c ] @ @!#] @!}\@\@#] `H$$@!D .0c]@#@!:]  o$@  @@@ /ĮḶ # '#] @c]@!E\@\@#] `H$$@!>D .0c]@@#c@!]  o$ oڰ    &@ :@@o @ /ഈc ] @ @!#] @!\@\@#] `H$$@!WD .0c]@~#@ ]  o$@@ /Uc]`@1#] @ ^^#] `H $h$#@ ]  o$@!$D*@ ] c]@ 0@a뀡 H "& 0@P瀠`"@ H`"`Hh& H ?)0?(o  "o'?? "'o0pO?O*p??o2@/,@ - @ .  0h.. @c>] @n@@?&@9 @ .H -o?o.@N/ᔀ`-  @D `+`?*@&@@1* `@&8`@:* :  /H :   d 0 H ?Ћ: `@HfA@ Hɢ9`>L@@*h " oڰ ?*v*'hc @] "O˰ o o @  @0 `` @9 @&8@ @  @  ` @9 @8@ @  ~$~d/㔀@HW @s "@Q ƀHƀ 2@I :EZ@13>Z@)@V "H4 @P @h, @I "H' \`"@%< [@@!  +0[@@:`G\`@3[>` G \`*Y@ h <  ]Y@ o< @/!( ]#@ @ `] \ @`@h t@ht]@#Zo``] [@ /pta(] @& @"@@@ @ ư?Z?oo ] @[o@#o]@Z@o؀@ /8` ]Y@xt /-ha( ]@ @6a ]  ఋ|d~dH ] h+D@H&@_1@| `@v]]@s@A@go H` ]" `$]hD]@Zo@/Da(]@`H ] @Z!]@`?`? `?@ /Ȯa( ]@ @%   )~$~d!Ѐ@ @ ]1@ @& ] h @@@ @< h]@@Zoۂ @/!(]@`@'#a] `?`?@ H!`@@h ]Y@@\@\ @t \  ?h] @Z@o#@!/V  !#`]]r@] @ @ a0] @Z "HA!@@ @()!]] @"@@ ؚ!] @`? `?H$! #  `а!0] ]  \@h!@%t]o!@ O! )!a]] O"@o !(] "@/㐈!(]@`@P#a]@`? `?@ @-3 )@l@hh@@)@@@`] Z   \@$1$h\ \ \ *?\ @"h@'o!]4@@ vh #@%] o] EZ@o#@@ /a(]`@Āxt a] @k"ƀe5! ] Z@@O ^@"^`^` J ^`*^@ @B ;`@Hq(pht  ]\@  ~td"@> ^@^` @^`  d~t 2O^@> \.phGu@ @ > ƀ^` "O逦> \*p@h^@ t@\^@@Zo܀h,t@ "O ƀ^` "O^`o ]o^@ ?@ {)] `@ #c]@$g] Z@ox@%/㠈]Y@\\  @\  @  @F ] r@ H@=o@9o\ @ )/خ !@G@tt ]Zt h r] @ H#]@$@/@ !(]@`@1$#`]Y@ `^ ^ *?^ `]X@%^ @"Y`v [@q`s@^   h@ov )] `@ #`]@#ہ]  Z@o@  ~$~d/mhH)!]@`@3@#] h. @')] @ `@#]`]Z^@ "@^ ^ *?^h @mh v @o@o@ )/*\!  /] `(h#Ѐ`H< ]\< Y  € h q @eo\`H< @#a]< @ڒ  OO@ /a( ]@ "@&] )a]  `?`?@ H!]  @0h @#3]h `@@ ~h : @h: mZo@ /a( ]@ @ < !] ?`? `?@ H @ l ]HZo @ /a( ]@ @ a]@ `?`?@ H `H < @@]"Zo@ /r|a( ]@ @ a]@ `?`?@ H `H @ W]Zo@/Ma(]@`@ a]@ `?`?@ H `H @ fh: ] Zo @ /&La( ]@ H ]Z0#)/a]`@r!!] @`@߰a]`$Hj!!]`pC@"V] ha!@^ &@R`@6ဠ`@#N @; @\ 2@No `@ a@B!] o"a]`H9! `@@"(]oưaД``] @"" $Oڰh@"]oӰ`H@"] `OȤ%P]@" `O `X@"]o$Oao  8@!]o!]D#/a ]`HF')a]`@: @2 @ )o'  `]]@@=@֒o H a ]  @$ @1a  ]h$@ @ ]oa `@!] o `x@ ] oΐ x@!] oƀ ]D@ /9a( ]@ "@]> @ρZo> @/%H@1 H3`#]][@r#] Z"@ *X` @*h& @] h"h  #]Y"@)X`oq!]`$H  @!S]h  )!]@`$H o`@/<@0-  )!]@`@@h=@!#] oN`/@( )В]@ H&@!]h"%]@@@)] `H!o )a] @ Hoނ@ )/Јa ]`@ ` ] @Y*@@$ H   @ `h   P]#@@@ ]o @ ]o @ /Ю$` ]H)@!8] `H  1 !!8](]\@]s"(] Y@ )  ] ]x\@?`@\ ht@ ]o\ @' /0]Y@@%\@@p\`@n\`@l\`@j %] ]rX@"@ #\@@\\`@Z #' cX]]] s"Z@ X\@@\`@F\`@D X]r@+)/R,a]`@  ] Z@    ` ` @Y^ *?a]@ H]@H!P ]@ ] !]Y@ !#)aТ!X] 4@/^^ *?a]HJ`@]  Ha X] [ ah@^`4@^ ^  ?a]`@.!!p] @Ձ@]o^ @]o^ @]`$O^ ]@^ $O^ ^ @]`$O^ @^ @]o^  @]o{ 0 )/Ԉa]@ @G.@@.?@' @4  @\@w h7@`$O!@] o@1@k\\ Z . . . . . . . h.@H!@\] h!x@V] o.@@ )/cpa]`@S E!] `@ `P]@`@6`@,# c]`a]] `[@["8<\ Ɣ 2@ \ *?\ h,<"@*<\@ 2G \`*\@h<!@] oo`@!h !]@ h!@] o@%)/؈]@`@w] `r `P]`@h@ @W@m!@ihp?@ @@@5@ Z @]  4@%hU@] $HN!@]hF] HA a]@`$H8!@]h1@] @ $Oɐ@|]o@w] @`Oa@o] oo@@ @h  @`] h !@[]o{ )/i㈈a]`@[  ] J`@ `@hR @<]hN @ϒo@  @3< @ @"@&@ "@$H1 b@]  H( !" ]@h!`@ h?"(@]h?$H %o# Obo!@] o @/H!)!] @HM b]@@`H !^ @ "]"@] !] @`@6^  @b] !Ј@]]@@'^  @b]@] !]  @^ @ ]@bo])!]@`Hx] @@ @ ^ @ ^ @ ^ @ ^@ @%)/0]@ @3 !  X] Z@ X][" \ @  "@ \ *?\ ] @ h<b@W]h<@L "O X@@h  b@G] h b@A]o! @ )/La]`@j"N@ !Heb@"] h`??@ ,p @/ "& @@ @ `AH/H=)?`8I/"O)h2ؔ@]o`@N/Gޒ/@8!"@ ] @ @ ˒`O"@]ob@] oN"@] o@)/Ѯ(a]@`@ "  P] `H 1h!@@] o !@]C@@%)/ं] @t  P] @ @i)  ]`2HR    X]]^@Bt #] X@Рc^@V[`*]^Y` ?vЖ ]] `@&hC c @Y] `$H; @Q]h5  4@^^h.\\[@D] $O^@>]o^! Oڂ#oH  1  X]][or]ZX`or<) o c@]o @ )/+␈aк ]@ @R  N`H @hN 0@] hI @;% ][ )+ #@- ``@`@\@$h\ \ *?@h)@]@ $O\]@\@ $O\\ @]@`$O\@$\ @]o\c8@] o% #(@]o@`))/Ʈ!]`@# cP] @7 @o'`@] "@ !/e@?;-cP]h]@ gwwאϒ  @/ G3b@@]3   -95#1wwwowgw_w7wWwOwGw?w'w@ _!+w7c_o;㐬#c_w_79wo@_g__c5#w/Ј_Wwww7!_O_G_?_'_wgw_#1wW`ؘcȒ؊H#cwOwG#w?w'w@?"`ѐ?L #G_w] @ 4@]@]@  @]@  @]@   @]@  @j]@  @[_?] @   @_] @  2O@@G@_I`;Oo_7 ]#@ِ@ _/_'_/] @ Д  OϢw w]Y@ ^@ w "G^ *?^@ Ӑ @ _v!v ] Y @_osqoqr @@ oj@_O]@ @`$O__G@]oY@_Wo]@_g] @ n@$OHo__@v  @ q] @F _w@]O5!_o@a]o1@]o?@ k!@ S] @;h, c@M]h' !]@;h cx@?]h !]`$H )o#p`$H  oX#H@(]o#@^/5⸒ :@ g v)!]@`@!h] @ ] o*^`v@5K` 2O^@^/ K@  ;@& @ ) Ȕ!] !] #ᘟ+ ;`@39``"@-`,@'*`^`v @+ 8`;@ O+ ! 9` ]* ^K@;@  Ȋ`v@4K` @ o^h] 2O*o! oܖ`?`@h]@] ]0?*+@  @ '  ///@ Q(p @ /x P]@`@1 ) ؚa]J@"H ] ] H@x]h  @ @a@m] oo) ] @ )/t㴈a ]`@#  P] @`@ ` ]`Jd` H@>] h bo] Po @3]o @ )/@a ]`@%  P] @`@  ]K @ H aH H !P] @] h o] o@]o : @!)/ !]@`@0   P] `@% v@`К ]~$J`? @ !] H 0]@сt "O!@"?!@h o  @] o @#)/ʮ a]@`@E ! v ]ZĀ \ ; @ /Ԯ@k w `\`@2]@ e @_\@o@ ϐ\`*\`0 @H w \@ "@ \ *?\h<`@ /` ] @ !8 ]  Z @ @ aPaP][@" Y Y s@h ]ot@  P!8] ] r@p@o$@/e@  @z ]@0+ `]@ d^@֐@@)? ?`I< @  @:@ ttoo)<@@!)  `] a!^]@]@ 0@ @ @"^  ?@h?@?9`H| @@ov o(|@ O@]o^ ))!]`@+ h a@]h  oa0 )a] H   @]  $H  !(@]  @ /ȮTaX]@`@' @]\@ ̀B@ a@]; a] @ /@1  H/@@yh*t@ @H] Y?ߠ   a)p /]\ @l ' @1 < @ *\ )poư@' @@Q]ot@@]\0&w^  ^ _[q  ?wh_Y`Y`Y @ w_Y`*?Y`h wY`Zq`_@q`o_0 /P!p]`@% ` ] ahZ@?]H@" h !@\w _ah @]`$] @_ot@@@@+ L@`@ @(` 9 @8` @  (``O(`  "H h@ @/ h @ @("@a @No /o/ᨠo@) :`=@ `+@ @) @`!@ o) +@J 2H ,@ !x@] @I@@ @) :` ,@ `+ @) @ #@o) +L@`"O , K@ @ @) > :@ `+ @) `@ !@ o) +,I@@ @) @ `+ @)  @ #@`o) [+zJۀ`@D؟0`☉+% [@ @t N@i`dOo *`? `? @$ O*`? `?@?h)a]@H' a]@;hog@Ioꀦ@Eoܢ@A oΰo̰ @9oǰ@5 o°o@* N`@(` 9 @N8` @  (``O(`  H  @ @. @(@ @"@'?@ /̈a]@  &@!]h&@@@S$ a]@!@ ] @a# ] o"@@ /Ю a]@  b!]&@]h&@@@$$ a]@$ ] @2# ] o"@@ /da]!@@1 /8!]@E3 b]`H )] @`@ @\@  !Ța]FC] @ a]H4 !ؚ!]] @+9 @ b]@`H#!)!] `@@/1 @!]@@'3 &@a]#@(3  a] @" ] o!@@3 /2ᨈa]@?# 1 "]`Ha)] @`@a@@a ]!FC] @aؘa]] @@@, H* @?"]@ H")a] @@@# @_a]@@ɠa@W&]#@1  a] @f" ] o!@@ /ծ4b]X@@   !)p]\ @ < *\  @/̐ @ &!`]@>Z@ eS1p h@ @# /la]`@ ' #@a]]*"*Wa>`@chRa@4@@ "ƀ@8^! !2]@>`@T!]! @#@ !] @R" a]@!@"  ] ] ]"@ z4$  a @] @@;) `!] ] @ɖ /o '@9&o ]$@@ /4ᰈa]A@@@7 @5 ^@2 ,^@ ) `"@?8` @I:` @  * `O8` 2H ? @ , @,u^@v@? @ <+p^@ ?ؤ h@ "@'/!]@`H4$$8] Z@*@ \ (  ] @@@  "X]9`*@ @ `@O9`] ` @ \ (@ :;`"X*]`"@o#@%@o֠8][2@ \ (  b]@G  X ] ;`)p"@ ``@O;`o\ (@@ ; )p*0 "   O: @?o"@@%oΠ@@@ /~☈b ]'a]h"]"@'/iD!]@`H?$$8] Z@5@ h\ (  "]@@ \ (@  "X ] ;`)p"@ ``@O;`o\ (@ @ ; )p.0  "  O> @o"@@$oˠ!8]Z@(@ ,\ (  ]@@@  X]9`)0@ G`@O9`] ` 4O\ ( ;`"X*p]`"o#@$toؠ@@@)/La ]@!@!aB b(]@@/ڮ@'a]@`H  ]@@ "X]9`* @`@ O9`>`@>`@ ]@@G "X]9`* G`@ O9`o>`@@@6`@V ">`@g@*@?@`@h L@Z@6oLoo@!)/o\! @] 'a]@`H(  "]@@ bX]9`* @`@ O9`! ]@!#@J? "@*?h@ "]@@G bX]9`* Gߊ`@ O9`o @ ')</ @] @# @ J?` "@*?  @ @*a@}?&@  < ]L@ @Ӡ?O< @)/L ]@'a]@`H  b]@@ bX]9`* @`@ O9`@@ b]@G bX]9`* G`@ O9`o@/T F?N @';) |a /|0p @]@@h+@@@  @)@s?@NO1! <"0@] @)ِa ]@^??f@ h; o?@@o/@/` @z'a]@`H  ]@@ "X]9`* @`@ O9`@.@ ]@@G "X]9`* G`@ O9`o@@@ 1?N @%  </|0p @h@@ @)e@?@N`Oh<o?@wo/@)/H! ]w wwww@: @wwww@: @)/ˮ̊! ]@ : 0/@ؐ'a]@`HG  ]@@ "X]9`*p@ `@ O9`@hC @_  h9> @  @G6@(_3 b8@|]@_@h >  "8_@n]o  b] @@G X] 9`*pG`@ O9`o”@/T@n $a8]Y@@4@W\`(  b]@@  X ]  ;`)p"@ ``@O;`@\`(@2@ @ ; )p,0  "  O< @o"@@!o̢@ /ܰ"`]A!0@  '@`9 @ o': /`w@hw '_d _@   d< N %@!O< @@! ?` M7 38H+0ϗ1 Б*% ^@@ +0\@\``s8s8`@O?`  @'w?'/'˲ @ <N`%@.@ < ) :  %2O.6@~_<N`%@_ %*@w,<`@6< HY *.@@ ?@R *O<ˀ`HF-@Ns@ߊ8߀@  9` bH]@/ު@?@ P? @]@*-@=  h@` hH l L"@<-@〥`H_f d@s@&@〢@@`3@s+Ϸ1`bp.%\ €G)p@__7@_7`'瀤&Om?_&.h=G+_@]woG*p_A7@uoG+0_ oY7G)0_o G*@Z7@e @? fGߥ(` <%`-|@ @ @@Ű`?@@o. @o. @oG._o@G,0_ow _'@͓2 w_*@q@<`_oo@.h&<`G+0@[@o]f<-@oH`߀8@ @ "OG瀠)0`?@@ @G\7?G@   f ? dyx'뀈@ @ ߀?@  '߀ G? L@ O߸? G? L@ `"O?oߐ@=뀢@'? @  zd& 'O oߚo'@+ߞ&@o'2O'o-@@4 *H* . $@`<`@z; H<`-@ `<`@q;` 2Go H˺o'瀤 H>>_*po_+0o'Oܙ<` O'o'ߊ @I` O؛<`ˀ`H ?`?`_*0'ˠ8oֺ`_+ 8o'.o +0<o+0^or^@+0@o r83 b@o]+0o$8<N%@@0N< @e @,@ Ц@<oN?``@,fo¦ *@ $@o@ G?`o ?` `o,7o?` '@<1 w_*@v@_ } 844444(44444444444444444444444444444444444444@wwww : @@@ $/a8]Y@@5@\`(  b]@@  X ]  ;`)p"@ ``@O;`\`(@ٱ> @@ @ ; )p,0  "  O< @o"@@oˢ@/O@i $a8]Y@@4@R\`(  b]@@  X ]  ;`)p"@ ``@O;`@\`(@5@ @ ; )p,0  "  O< @o"@@o̢@ 9`  H5 H` (H` @% @ @` H`` h!"@  `@`(H ``@`"@  "@ `o  O` 8O o``O o` @%0@:  10(P?cH)pZ@@r@:  10(P?cH)pZ@(@r@?: c1p(pH Z@0P 8` @@@@: @ /؈bp]@ 0/@n  P@,ݐ t@ t 0t 8$ t @)t @ H?@$ ( H:@N H5@t\ H0@瀢 @G@ @B@  @=  Hbh]@ @4@ 2@ \\ (@\ @( "O\ (\@  H""  \  \ ( \ @t@h @!o@o\@o\ (@\o@C @^ H>   @ ^ @^ @4   2O^ @f^ H+  $`"@" H^ ^  ^ ( ^  @zh @*o@o^ @o^ (@o^ @  o& $@3 @^ H.   @" @ H & D& @@$^ H @^ 2@& h @^ ^ ^@v "@ @+@*h  @ H "O @ Gڂ 0  ~$~@ HL @^ HG  @^ HA  H'`H &h8@^ H3  @ H & D& @@ D&@@^ H$ @q^ "H & @2^ @^h O H@w瀢 H_瀢 H  _ ?g& $?А@o@ /ᔈ"x]@`H @: @`?@@*@+i "@@@@  @+[ v @/ @ ?$ h$ @ @  @s H@ 0/^dX  @g @ hO bp@g] HI   @:  "p] @b H< < @L瀢 H6 H3 @L H. @>  @@Ih$ @= Ot & & @:뀢 O< @%〢 "H ob @O   o& 0/B  @ 뀢 @ h: bp@ ] H4 A @( `H  ?@&  @ "p@] H > @〢 H h  "p@] 2H  > @Ւh `Oݒ?o& @  @* v  @ H @^ @@Ԑ H @Ű @@ϐ`? @@ / @ @ hU bp]@ 2HM ``?&`&`@ۀ 2HB < @{׀ 2H< ƀ4@ ^^*_ߞ#@ +wߔ *w@ 2H @_  2H  ! "p]@_ 2H &`&`@_ۀ 2H < @IӀ H > h @yoް`?0^ @9@3  @o & @(z& v ^ 0^ 8^}^ ( @& ^ H @ H& D& @^^ H& `^ ^ ^v @)l@(v @ /⌈bx ]!@ @ /ݮ`bx]A@@/8a^ _^ ]^ [^ (^  ^ |^& u^& n^& g^& `^& Y^& R^& K^' D^' =^' 6^' /^' (^'( !^'0 ^'8 ^'@ &^'Hc@]@@o &@o^'@@o^'8@o^'0@o^'(@o^' @o^'@o^'@o^'@o^'@o^&@o^&@o^&@|o^&@xo^&@to^&@po^&@lo~^@/g'X@j   @o'X =@`   t @o =  e r" N t W o k]++ + + + + + + + ++ "$'PJ`@ h $'P @7] b@ ]V$'P sq o m ($8] r@^ H ,^ ( %^ @ ^ X ^ x ^ ^ @h@o^ @o^ @o^ x@o^ X@o^ @@o^ (@@*ד,0@   @wo,0v @@ )/xa]!@@@ƀ^@ @@ >^@ @@^ ?@   @t^ ?h@o@v^@" v @vhv@2H\hv*@\vht "@ \4G\\\*\ovv@  ~$~d@H)v^@& ^@ Y@v^@q@v@^*^@h^ G^ 2O^@^@v@^^@v[@v@s@to ov@  ~$~d@H"v^^@@ ^@ ^^*^@h^ &G^2O^@^@Yv@qtoov@v@0 ^@-"v^ @vh#v@"Z@ @ ^^  h H\ ^oZ@&G^Z@t@r@t@ o\ov@  ~4~t@@  h~'ƀ   @ : ^^@~4~t2Oo@  ~4~t@ h~$ƀ @ H^@^ ~4~tOo ZY r@^ @`h(H>`^ ?`>`@'(,0r^ v ?@  ,0`@@ Zr@`ZO?@_0w6 H\ ?@>w @  @ \*?wh h_@&(pp@\ ?`6@[ Zw@%_0w@ wƀ "@_^*?w @% /l]`H)# $a8]Y@0r^ "H# ^  h)☒!b] @Ӑ @ca#s(p 4 t]  $^ hbҐ"?Z@ɐ/o@oа]@Ȟ@ٞ@@@v  @@@o  @@@h7 ر>  @@@_7'')0*p@@@S7(9(A)0*p> @@@F(͋)0@@@= 10@0@瀢 _f`@@+$k)0@@@"(@)0o0@'+p' +0>`>s@@@@N @ o !)p7)0@Ε@@5%'')0**p @Ǔ@@7#ג%)0*p@Ó@@9(&)0*p@@@9(Œ&)0*p> @@@5(ɒ')0*p@@ $/a8]Y@@%@#`"\`N@ /@ 2 b]@@ ;, ;\`@( @1 oz @oۢ@ o@ $/Ǯ8a8]Y@*Z @Z - /]@`H  bh]@ @#@ @ޒ /  by] @ /9<;  :@΢"{ `<c@*?h~ @\42, @]@u O@@jo O O % /]F ?ۦ@ /?ע @: @( ,`b*] #)a]`@ "] ]@/L q Q`? `? @  ] $h*]@P;'9 c"]]!# r]@@;o @W @o Oh@o! "ot]@ooڐ o@@Ӡ@ H  "` LL /@ Hh `/2OL@wwwww@@wwwww@X0/ @w@@Ր"A@@p _c@]  c_@] @_) ] !w  _ߘc(] @_@}hc_@] ? c _@] ? _o@/@@G@"@P@m )! ] @L0)/`! ]#X@@H=# ]\ € )a ]@x c0@ c(_]@!_h ]o@_ @0\ c(_] @_o)]\o\0 /@4#Xw]wwww)\a @@0\^  c(_p]h_]@M  #(__] _@@ / Xc`]!@@/,@  c(A] /c`.]@`H @ F #8@v] @| @@k] @)/ʮ\a N`@ cP]  H'H]v]@u3)  X ] a q@]  @b耣`H]`@") !]  Ho] @ )/paБ> ]@wwww@H@@)/y !АcX]@@H]\@ €  )a ] fʁb\@o)@! /U∈#X]Y@@") Ha]  @#X] hs]o#X@ /4cX]Y@@ /+cw]www?@5)> Д ]z@8 H )@ a  @H]k!`  z$e0H@@0/@b@l͐_< (p6 #@ *  *pwH" )0w``@ 2@`$`` ?#h2`]$@@/Ϯ<@5 ` H @P ` h]@ @8`  /%#pa(]@߀`H  ] w@<#@'ϒ@ @`> @/ @4 @1 @. @+ @( @% @" @ @ @ @@d@:`@@ Hr `c"  ;j"c"  &." `  " `v 0" a" @ .@:H  `&  6& & ^ `@? @#`f@L&@^ ``@hv `@?`   @@<`@@?o@2v `@``4 ? ?:@`8H*  @9`" @ :@z`@&`&` &`$&`(&`,&`0&`4&`8&`<&`@&`D&`H&`Lh &`P9` 8@ @;`@a 4`4`4`4 4 4 .`V.`T.`U.`W.`X.`Y.`Z.`[@o@.@. @2`. `. `. `. `2. `. `. `. `4`. ` . ` . ` . ` 2 . `. `. `. `2. `. @C?)0  @ﳐ@Fo {@  cx /4 8`@] ?O``4H.@.@```$O   @?!`O  ? @~~@~~?6'~O` ./ 7 @@.6 !@@.@.6@@@7 / @@+(`0`@@6.@.@1 ) @@@0`@(`@.@ 1`)`@@@1 ) @ @ +@6 . @1`)`ö@+) 1 @@ 6 . Ǟ@.@ .6@@1 ) @ ˊ@+/`7`@@6.϶@@.@0`(`@7`Ӷ/`@.@@ 1 ) @@@0`ױ(`@ +@6 . @@@1 ) ۶@+/`7`.@@ 6 . ߞ@@.67`@ /`@+/ 7 @@@6.@@.0`(`@7 / .@@ 1 ) @@@0`(`@ +@)`1`@) 1 @+ @ @/`7`@@)`1` @.`6`*7`@ /`@)`1`.` z6`c@/`7`@1`@)`@@@0`(`@7`/`@@ 6 . @@@0` @@(`@@ )`1` @@@6 . @.`6`@  1`)`.6@@.@ @6`.`@0`(`@6@) 1 @ @0`(`@ .  6 @#1 ) @@ /`7` @ '6 . @.`6`@ +@ 7`/`@@.6@.@@@ /@6`.`@0`(`@63) 1 @ @70`(`@ )`1` 1 ;) @/`7`@@  1`?)`@.`6`@C7` /`@) 1 @@@G@6`.`@(`0`@@1 ) @@K@@ @/`7`@O0`(` # ܊ @@ / 7 @7`/`@[S@ @6 @ . @@@7  / W@ @6.@6  . @1 ) @@@6@._@@@@ 7`/`@@1 @) @@c@@ @1`)`7`@/`g  @/ 7 @1`)`@sk@ @6 @ . @@@7  / o@ @6.@6  . @1 ) @@@6@.w@@@@ 7`/`@@1 @) @@{@@ @1`)`7`@/`  @/ 7 @1`)`@@ @6 @ . @@@7  / @ @6.@6  . @1 ) @@@6@.@@@@ 1`)`@@1 @) @@@ @ @7`/`1`@)` @ 6 . @@@7`/`@@ )`1`@ @;2 . 6 a֞@.`6`@  1`)`.6@@.@ @6`.`@0`(`@6@) 1 @ @0`(`@ .  6 @1 ) @@ /`7` @ 6 . @.`6`@ @ 7`/`@@.6@.@@@ @6`.`@0`(`@6ö) 1 @ @Ƕ0`(`@1` )` ˰@1 ) @@/`7` @ϸ 1`)`@.`6`@@Ӱ@ 7`/`@@/ 7 @@@@׶@6`.`@1 ) @@ۋ7 @/ @7`/`@@@1 ߃) @@@1`)`@@7`/`@@/ 7 @ @@@1`)`@@7`/`@ @@7 / @" @@@ """" @/଀H66 @̖hS@ ; !` /]@d@ @+)] `@! y] 6 6@0 3)a]`@ !`@!\ 0a]h \  ([]o6 6@ )!]`$OԐ !\ ` C]o͐ 0/$ :@灢9*@" ! : H,]@*  @"!`P @"] @' #]] #r^@ 8 h?6@h86@h1N /@&6@&'!c 8] ] Z@ G#  )!]@`@!! @]^ h @i ?װ0/'X H@ǐ  c !@  h1`#w ]]t t@t t @?_23Y`@*  @@ @Ҡ "  @ hv q`_v@^ \ @ @懐hv@o㺰 !/ݮ0#`Po] v]  :@N#'@T@!I6  # /]@A@cȐ]#@ @cȐ]@@  |8ep@@v +)' aТ㈱> ]cȒ @锠< `Q@] `L@ @|8 ep O@漐6@g@Gh_g ] @Ԕ_g[`(@)(@_g $b]@`"Hv`0"@[`hv   @ 2O_g _g&`0o_g!]@G ] o_g@B @@z@ @B]hoo>  !퀢 H @ !퀢 @@!)Bڐ !]@`@T@ @@B co]@ d!ɀ O@2# @'@ o # ]] /@r@ߐ@枒o 6O8c@ c@] ?. c] 에o'c@3)Ba ]@ @@TB o0/Ů @嫒 : z @] H4w!``]  s`_q @_$ 8_ 8 @( ;   @L t _[`?`(X] `@$?0` [`s`(@_v_Y*v@N "嘐@HB0 @&hvh    @ 2O_ _" 0o_@^ :Y@ @G z@@@^6 @.\  8 xtz4 "H  8\ "@  8 0`@ \ @\  8 @ \ @ʐhv@o@Z: o\  @Ě o\ @,o\ '/#v]>`A@ @Ɣb @I !#`H]] :9`@y! @~#]@q6@K @ꮔ h@_[`(@)(@_$"]`"H3v`0`@h-v @ꖔ O_ #`0o_]`G #b] o_@Br )] @`H @~@5B cؒJ] 0/L @䊒 : z @< Hcw!  ] r ]_q _@e`4 @_1)3 !В]`@c]@EB- 䍐@Sh@v 4 &G1)@ݐt_\1D 4@- t _Z ` )] @`G oׂ#!(!X]@`2@B 4?0`#Z  @  r (_hv @ O_ " 0o_@ o"@^ 4@   @< @@^) @!\  8 zty4@"H \ 0`2@D 4@\ \ @㠐hv@o @鿔 o@o\ @)/ta& ^ ("@]h (@ @ @c]@!/خ X ]c`H !Y]!   ]z$&"@ ] C@^ (@ H   $ @)/ta^ ("@]h (@ @ @c@]@?!2!/ r e@1a`$ fb!!!` @A``kdA` @8`)0] *0#@9`h]@]h o v.@.`.`.`.`.`.`h.`o] 0?!2!/ r e@6``) f"!! ! ȈО`@B``j dB`B` B`)ps.0"B@; ]9 s@⨐h]@]h o v.@.`.`.`.`.`.`h.`o] @ !/v @!] '#!]Z@] !@’"X @' !?# !30!/Sx  `@) "`$]ɼ'! !`а`  !]][@@"Xh]] ^ ;ɰ@Zh] o[o]@?!2!/㔀 r e@+`` fɃ! @"X@i]h n o - t i m e.@.`.`.`.`.`.`h.` o v.@.`.`.`.`.`o.`o] @' !?# !30!/ܮ✔  `@) "`$]E'! !`а`p  ?]]_[@@!"Xh]] ^ ;R@h] o[o]@' !?# !30!/ᨔ  a@) "`$]'! !``x  !]]"[@@ "Xh]] ^ <@ᦐh] o[o]@' !?# !30!/bഔ  a@) "`$]'! !``  !]][@@ "Xh]] ^ =ذ@ih] o[o]j @T@@/@@"2* @R % @ ~@v@& h)6@C v  @@ ;`^ )0` @O" h@q@'h @kh  @ !>`oao]@@^ @@V /p#}a T'Ө~0Eת!R%4`%"4ș 3!a ?]@ǐ@?@ :_@^ 0@ې@ @ՐA?_@ _@ΐ@@ǐA?%!]\@!!P( ܨ\=  \]@@@@ঐ~?\ ƀ  @@<O @g?O` ( % "@?@B 2H')"@ %_@@C`_@@E`` @%׊@``@)!Р ] a0< *p @@  `@8`@ &@ O< )=ע@  @ ?pu v v v @毐 @泐 %v    }נ@ ``@a#/ ^@^@ע` Hv@_@   )p < >_.0_ ƀ?@!7ׂ@@ @@!!!8] P@] ut   @' t ]t H@f%)v@]`@@ L@ +!B@aH]o@Wo%)@ ?o7@W)2O#)! @E]@S#@'o@,@^@ok O@@B]o@o:@g `2 h: '`: @,_`o$%]`@: !^@!X]=ה ` @@+!^@a`y];}ܐ @"@@@ihB`H 8``H:%!@h^@]Y@Sh,?}G ?#Oޒ] `G! op@m1)!]@`@ @e5!B@P3]@]o"D@o?@/Ů @ r@hr @8``@-@l)!a] `@x>] @h!@+)a]@`@ @"@B!!P] @"@h?@A@@  0^^ w@w_ߟ_@  ^ `;`*p^    @Ǒ0`r ^   *`;`^s)p^  h@ذ  "@n?H<`T @2O<`h@&o@ !/(`a ]@ ) @+! ]@!  @@ @ԑ> @ @@`@ɑ> @ @@`@侑> `H> @@ )/t! ! !]> a!@ސ @ @i`G @< @@]B-]h @ < @]"@/@C> @丐 !a ]@ А @'!#] ] Z@\ @Ԑ@""@@2 L@ H. @̐@*` , @ L "@, o?L @ 9 @  @o ` L `@   ,@9 L 2O ,@ P@ݛB!`: @+ M @%@KI@ @`K@ @? ?`"  L O . `d`"`@݅ho @_N@,@`)0@ݏ>@' @@ $/Ⰸa8]Y@ā\9!"] `HV#!#!;!b)!]@  b"] ]+!@㩐  @- 20!Ȉ ` P@] PH ` H @q`"  }t}@ H-!x]bb"!] )!@ゐ !] !@|b]L @=b#!"bb]]]? ' 4#ww w w w b@I]%`0 H   +)f 2@ \ \ ?%bhB]?G__NJ" _m@m@o o ] @Lb`"O#!!"@ܖ] b@ܓo#!]od@`"H `#`!O !a]!o] @`$2O !o"!o!oGu pOt ` @ Oo !!oi]'! !!Њ]ob]` O_ 1`"H*p%\@ !ob!o!o!o" !oނb(!oۂ0!!o؂"8'!oՂ@ !o҂"H!oς"P!ôbX !oɂb`!oƂh!oÂp@obt(@%]v 8\(4@LXdp|@ !/®!"]a]@۸@ &/ᐈa]X@@  )0\@ @  <  @*p\@ ?)0 @ !/bȔ ]@۴! b`H,@۫] #!`"H#@ۢ]! ("H@ۙ]! ؀`H@ې]!`H ]@ۆ H @/V H  !"@ ]@n  2H  " = "0pss_sgso@ hswshss[[# @'/T %] !b @ @#&"h] @ P@# @] h] @]o&@'/Ю!"b]#@a`H 1$] @] !8$] cZ] @ !8][@ &/(bh @] ' H!)] `@!@ "] o]#@@/n 'b]!@@/p^Ā ƀl!ĀR ! "c@ڣ &~ `H@ "*J @l]"E o , * `@  \8``"@/ `H* `\"@** ,`:\ @ * f``O `2H,9 & J "@, \,?O , ^@ ,^  ,h63 , @oԠ +`G, @ ,,O`o^   c)p`@9^]`@ ^ <`)0^ ?@k6 o}^@$^o &@/gv d@ 3 d(``@.!!#(c8!w!0#H!%!!!'!))c@wǢP#XcwwwϪ!wwww:`;@U"N. ,`O"vF@/0htN`'"@Ӏ Hƀ`(` "G H`"` G怠` "G @ܟ @ z4@HJ\"@J `?HL@`""@oL @g$@F@)p; t`F@*\ . "H]L @ )`<`\"@KL .    )``O)`.] 4@5F@@ @O&@ @b;`F@@-0@@ٍ`O_F@=]o &@ __]]]!%ڰ  @qo&@_+0]n\ o@ O .o F@+ot \O*`  ?*` L\"O? o Ox `@?J \GvJ `O`op_oT]OP__  d@oJZ@@``OD oC]_װ o?]O;_ϰ o:]! '#c ]]Z@!$o v 0 !/dc]`@ߐ `  @ !! ?`20 ]# `(`3 hn'o$>`61`3 3@2`    @ @`@@" "" " "  B @ ``??`?@@` e  `?@ `2H @ؤ߰ ܐ@?g`@ $/xcH]`?@ %/tHah]`?@/i@ ! ` @ !1`")0%Z H+@Kch]`@3!c] \!#] @`H&@&@!\F@!*0c"] )p!@oвc]  o${5!p]@ , ,, 0/ߐ#! ۠`   c !cx]@ި - 8`@] O 4H,, $O  0@뀡 H '?뀡 @ 20 2   @ /h@N @o *΀v!#]ss@ H5 !  c ]@`  @& 怤`,O 4H   *:`-@   $O ZߒX  瀣@ H ƀ 5v @/k$ @ < c" $9 *0@@ (pt 0 /SĀH,9 !c`#8`H +p &@ )0v h ']DH';`&*0@ *pF *^  @ו)p@3^ ov 9 @,0^ +p"@ @ `"`"` " `" `& @ ^  @@ov @@ @  @/@P / / @J@N/ \"@N h \2H !N  c`?@ h @] 2H  @ !/ܮᐈc ]@! cȀ`H ]@ǰ  !`#H]@ֽ !ؐH ]@ֳ  d@ @/ H, @ / ! # !]@֬ ! c耡`@h> ]@֠  "H> !L `:G ]@֓  of`@/uu H: @95 @֪ /,*!@< ~ ! c@T] @ @ > Hn@-@)?@9h> b@[ Oo @, @ @)- H#@/ ?h@ \@]  \ʀ @W@(@@h@@ "/`]v &@ 0/1" h]_@/@ >`9"`Z@ջo]@/Ϯ`@֊>`("`Z@ժo]0/ !"? " (`0] "` ] s] / /@{@ ) "aЀ  H] "] `8@"] h ] "]`@ @#o] @@v80`9 @@u80`9 @N@/Ѐ H*&h/  ƀ,? " `]@`@$: ` `+; @?`` N@?` @8`@`O@h Y`Y` `*ʀ"; @/p% ">``]@`@  Y`@` `` @ 2OY`h?` `>P@@ . >P ?O.;`  @@  N H<   : ? @N O< 0@ `@!ߦ |8` $@/߈9 @`Ā @ ? @ ,` O?`@`O8`*,ho : 0  ~$~d@ H! N@ "@& |<   9`@8`` @&N@`O &h< 'o 0  ~d~$@ HD @c  "H@@h @g@Uh2@Xo)?)``"@$,ߦ |8`:3` $@/߈9 @:`,  @ ? @ ,` O?@* `O8`,h<o  @0  ~$~d@ H, N@ @!   `H@?.` < @ : @` @ < .N@ O .hN@ o'@  N H< @ڬ  : ? @N O< @@k  H@m@ <  "X@ڇ@)=,@ӣ@|@@@j\ X /@Ut X/q\ X@"\ X@@o@ @`@ӌ< h@Ӹ? "@ϐ@V@ @O@s< h@ӟ? "@@ԏ6(@?8`;  @`(@@3 `@D> h @(o@l? "@Ṓ` /  @@6`@B @  @h @, ?@ @H@@A6`@@:>`@@4@@.@@(@@"@@6`@@@@@@>`>@@6`@@/dZ  hZ @gP@It t \ `\ "?``Hh \ h ]Z @Ҋo@/̮T;Z  hZ @gP@ t t \ <\ "?``Hh \ h ]Z @ao@  5 @=1<`< ? N `@` `1` = g  `  @!``@ ` 9`@`@*o< h<`G  ``G  ` G  ``G  O  @ @@k@`@2@ @@*0`@)L `@@ `@E@@ (/`]@ (/Ἀc]@  ̀ @@Ѵ@v ` @"v@@' N H#N "@No  @`L@`2O`@*``L@ 2O`@` @,@,@ @@     ?` @l@.   @۔"t^ ?*th@9o0/}"`^  h v]_ @ 0/bv(`^  h vݲ]_ @ 0/G[(cؔ^  h vݗ]_ @ @C^"@ vY@"q@Y  q@@  ~$~d/T@H^ ^@@ )] @ H"`X] ^"v^@*@X@v@X@Y q@v@@^rv@   @ @^ ?  @   @ @^ ?  @  ~$~d@H " @   @Ȑ @  \ ? ^ ? @Џ@@^/lY " @ `]vr@@r^ ?@q`@ @"@ `h @^@ `@ 0  ~$~d/b〬@H ?^ *0  @ *p9"` "!" Pw]  wߠ1"@ ] \:h _]\ v@ѐt" ]w@ ) `@^8`@:` @` ,@  )``O`,@ @ n^[ `?~t@7"_] P] @ߐ _@@:h ]\ 6@tw@ +`@^8`@Ҳ< @# ,@  * `O`,@@ P^z4\ `?|OӠ@  ]`?}Oh=`@|Lo,@@ϸo@tLo,@@ϰo @@@^  @ @\ ? h " ^"` \\t@th ov0wwwwww`_@ `_@/'@4 (r h\ \ ?`"<` ]\ @ z4 @!t\@ @ @ ^ \ xt Oh <`^to^`o] Z ?`8`@   ?`@Id?^ ? < @^ `?|$@@ \@@@ `X@@@2Oh'&\rt@^. @^@  X@@2O"@ Z@  H^Z?vh@?`^t5@  "O^@  ?` @ @^ ? h??< 00  ~$~d/̀@Hi )0?q@? " s]    #"<|  ZZ @k @g 9 5@ռ H'[[[@sZrY"@'0Y ?ܔ'0]@ @  30[ Ϥ\h`roGꀢ GX@oY@@/E  )@ \ ?`=`i `Ho`@A`i < l`@?O^@@'O\ @f7";"`x]< Ў`= @<`Ѐ`\|]\O^@hFt o5` @ : `@ ?O^@ @0"" px] < X`= @P ^@L]O\h @"`h< =]O\ha ]ova< 0@  `@͉` @̓#< R /| K@Ғ@1Z h^@^@(@Q\`p@ @:h N\`x @ t`xt`pN`H \`x "*\`x* \`xh(`(gp`@/ (`9  : , `? `?@h ;@f \@d @b "@` #@^` J`H `  `?`?@ @O`@ (` O؉(``H\`x "** @.  \ 9 "\`?`? H** *9 ` "@#N * *:  @'(h * (@` * Oٟ9 `"H* "*h*o `O*o*o @ou\`x@/p@s  "`]\` ׵ H \v@h v *v@ hv @oot@̝@@"/ɮ" `]@`H  #@]" ] "] !@@ "/8`]`@-"] \`"d @ H'#"`] Z0]\ %"]@`H#@ӳ] h{\o@oto"@ 0r r "r ]@"  ࠱f@]r 0ը\]\@t (t@\@ "/UԈ`]A@@)"/LⰂ '#] ՋZ"0`Ј ]] !@Z H8\ (\ " ]Y@"`.q@t`(\ @ ?0][@ \ \ (]Y@"`q@t`(\ @ ? %"]ձ\A\]\=o\ oo\ oע@ "/h`]\`  ַ H  \h@}ot@Z Z@@@ "/Ӯ̈`]!@@%"/Ȯࠂ ]Y@ # 0]Y@ ^ ` ^ ( ?] ZS^ "?`2O]Y@"` q@t`(^ @koo^ @ " " / `]]q@@ "/㐈` ]@s @w @\@o@lo"@ "/Ϯ` ]@5 @Y @\@No@No"@@ @o@ @@@`@͋@@ h@ @ˊ@@ @~$@f @? @@ < @m?Oh Ҋ 2O?o@g o렄?@?)0  Ҁ< Q  O< @> I@ H ?? *p >; ?*  @" `/]@  H?: @`+` ` 9 `` +`H8`` e ! *`@ @K @ )``O)`+` @? H+)]@@ ": a:] ~>h&@ "!] @J`@ )` >`+` ` 9 `` +`H8`` e ! *`@ @K @o )``O)`+` @e? H ")a]  @ 3#"`@a]: B] 9>`@]hj"! +  @E]K@A ?)` `;``8`  H;`! e )` @ .  @  )``O?. @? H7)] @ 3' "`!(: ]] F>o`K O)h oJooJoVoOoM] @`H " ] ҁ?o o@ &/L`x]@`@#)0] H$#"a0Ġ]@ȕ@ǐ , @ @  ?h @ ) 0!@] o"@ )/Ůtb0]@`@)"Ф] !8@@@@y]@  2O@@@1  dg: @ $/Ĉa8]Y@\ \ @  7t#\ h @Ho+o@ $/خ8a8]Y@*ZZ@ $/Ȯa8]Y@@ \& p@Yю\ t&\ h\&o@ $/`a8]Y@*Z&Z&@ $/ a8]\@)"ah&]\& %]\`"p @] H rŐ svѩ\`hooo\@Z@ $/Z@a8]\@'"ap&]\& #%\`@ǰ  H r rߒvs\`ho{owo\@Z@ $/$ha8]\@)"ax&]\& %\`"p @x] H rW rv;\`hYoCo?o\@Z@ $/㈈a8]\@)"a&]\& %з\`"p @@] H r rov\`h!o oo\@Z@ $/⨈a8]\@)"a&]\& %\`"p @] H q r7v\`hooo\@Z@ $/|Ȉa8]\@)"a&]\& %G\`"p @] H q qvГ\`hooo\@Z@ $/Da8]\@)"a']\' %\`"p @Ƙ] H qw qǒv[\`hyoco_o\@Z@ $/ a8]\@)"a']\' %\`"p @`] H q? qv#\`hAo+o'o\@Z@ $/Ԯ(a8]\@)"a']\' %ϟ\`"p @(] H q qWv\`h ooo\@Z@ $/Ha8]\@)"a']\' %g\`"p @] H pϐ qvϳ\`hooo\@Z@ $/dha8]\@)"a@' ]\' %/\`"p @Ÿ] H p pv{\`hooo\@Z@ $/,a8]\@)"aH'(]\'( %\`"p @ŀ] H p_ pvC\`haoKoGo\@Z@ $/㨈a8]\@)"aP'0]\'0 %ο\`"p @H] H p' pwv \`h)ooo\@Z@ $/Ȉa8]Y@ \'8 @"aXpP] ht'8o@ $/\a8]\@)"a`'@]\'@ %l\`"p @] H oԐ p$vθ\`hooo\@Z@ "/ta ] )z4 !]"@ Hս]: 㴠?/w_wg_@   ~d~$@@? /@  z @Ą@ā@`d@?@z "H?'"Ȕ] / /@dO/d@ /@̐ -")"Ъo!,?@ < @(@#@Ɋ? / ,@į / ?u?@?)"o!]@a?"@4)"ʐY#"B l da@  @ `.09 @ *] $B ?`@@+3" a~@=< @ @]#O!@ĕ])"-""]]@a@ ?@ho !@Ę!?G"] @ސ<`@@g@čhW "] @̐o_" @åy"?`B?O_ /@# /@@ *@û@ø@õ`$@,?s] /@ß /@óoW /@Þ @Û@?]@Ç /o!ӓ.0?O;? @@ @@ ߶  wN @ h @Č  @g@"hu`#u`@Ğ]`[u`N`^@-` ]`@ `P,<  @Ѱ `@ħ: < `*f@`."@ H`[`$@`*@,@`,@o`",@O@ G@ G`o/@N G o,@@:`\2O,@,<  (@( `@: < )@ ϊ `8O,@ ,@`o,@_׀` ?,@o@h @ "O< @ϐoߡ* G /,@ `,@o `,@,,<  ^ @U `@G< <  G׀ -"@L]`,@`@gΦ,<  ]O os/``O ,<  ]@% `@: )` G< ]` `,@`@ gL Oo,@@ō @o @v o* ,@oТ`: @{ O< @fo*  , o,@k O<< @Vo6* _׀ gw ,`,@h  o-`@^   qq`H?O L @:L`"@L@K @4@+` O`h- LN@<` @@@ @ *O`h@+ "O@h@`O@o@ d@@ ^ @-@+o@/N`@1`#*% Z@NN@N `@ `@ HoN< @Ӑ O@žo@N,ovN@N `@`N "ON@Ĕ @: @o h< @ī "O@ŖoN@ + O`h@,`O`oܲN@N @ `:  @ @ No< @ā "O@lo: N@N `@`: o < @n "O@Yo: N@N @`N: @`? 2ON@No < @P "O@;oNN@ om`hA N*0@oOq Hh9?N?*p@\ H€2@Y @,   L# :o:@N?,pY`H``L!<@@ @@o@ g#< @: &@@*oNoxxl lh@.p@^LLࡀ` @ ࡤ(`N @ @ ] H o h>`@ü O@ħo>`@ò @o @ěo `H J@  J:@ @ ?2OJ `?@ @J? /"@*?@ / "` . *@ @ /ww_r @w_ ?'(#8] "@: wh2_"@'뀢 H _@y: wh ې "b] @'뀢 H _@e: wh _"@'__r@: w_ /w_ ?'(#8] "@: wh_w_ H _2 @_"_@-': w_ |/~wwwwwww > " = * = *_ ___ ?'(#8] "@:  }W@r@h >А  @ >Ȑ  >А r_ _@_r_?r@_r = _r@ =p _@'뀢 H(#8] OH ?':  WrhC뀢 H( =p  < @@H =p  < @ @H_r_?r@_r':  Wrhߔ_@'뀢 H ?':  }W@r@h = Z2  >    @'뀢 H  > "?'h = Z2  > 2  __ט  @'뀢 H0?'_ /@?Ȑ r?Ȑ Z?Ȑ Z@ h?Ȑ Z"b] @j Hs?'ho = Z2  > 2  >  __@'뀢 H?'hO?w = Z2  > 2 ?А s __@'뀢 H뀢 H(#8] "@?'h"? r_? ?А r? Z 2 w_ ? r = * = *? Z h? Z 2 w?Ȑ ? ? Z 2 Z r? ?Ȑ  Z@_@? _ǐ@*? ? Z   @? * ? "b]  @o H? @_ǀ@h? @w? _ǐ@*_? "b]  @F H? * :  1H =  *@_? "b]  @& H? * :  1H =  *@ >Ȑ ? ? Z"c]  _@ >Đ " >Ȑ  >Ȑ  >Đ : Z r?  Or? ZZ? ? ZZZ@ Grh =Gr }G@Z@ }O@Z@r@o = Z2  > 2 >А ? s __ט @|'뀢 H?'h? "? ? @ Hh>А ? 2   *0    H ?  r*@h?  -*@>А ? 2   *0    H ?  w*`h?  -*`>А ? 2   *0    H ?  t*`h?  -*`? *  >Ȑ ? 2 >А ? 2   *0>А ? 2   *0? Z"c] \[ @ >Đ " >Ȑ  >Ȑ  >Đ : Z r? ?  "o0?  H  > ?r@hH>А   H  > rh9>А   H'?  H = H  > ?r@h >  > Z `rh  > >А Z r >Đ  >Ȑ  >А " " >Đ : _@h ?'(#8] "@hw_ >Đ : r >А  >Đ : _ @] >  (@t > Z ?'(#8] "@hI' > Z = Z" > Z_r` > Z_r` > Z > " > Z > Zr _ > Zr_ > Zr:  Wrh3 >  H = Z2  > 2      @  > "__@뀢?H?':  }W@r@ WZ/wwww'_r"#8] H?'(#8] "@: wh__ ?'(#8] "@: wh~_wߔ_@'뀢 H ?': whk_2 Ӓ  @'뀢 H'Ӑ?'h?_2 ӗ2  __ט  @'뀢 H?'h* (@!w_ ?'(#8] "@h'__"@__r`__r`_"`_r __r@: whӀ H_2 ӓ2      @ ,'__@[?': w_/www''///___ ?'(#8] "@: wh_w_w_w_Z Pw_ h_ǐ "b]  @ H__ 2 Z@*__  2 Z@ R*@__  "`_ǐ "b]  @ H /_ǐ "b]  @ H_Z  * :  1H / '_ǐ "b]  @j H_Z  * :  1H / '_2 ___ 2 _ǚ _ 2 s_Z s ZZ   @5'뀢 H ?': wh_Zwov H,"c]  @_2 ___ 2  s"#]s ZZ   @'뀢 H ?': wh[_2 ___ 2 2  Z[`@'뀢 H ?': wh@_2 ___ 2 _2 _Ϛ s ZZ@'뀢 H ?': wh_2 ___ 2  Z[ @='뀢 H ?': wh': w_/Ϯw'_ ?'(#8] "@: wh%_w_Z Pw_ h_w_Zw_Z _Z @H_@Eo_@@': w_P/www'?H r?@ r?8 r_r_ ?'(#8] "@: wh?0  X@0t?0 Z ?'(#8] "@: wh?0 Z  X@_w?H Z_@ hh'?H Z_@h)_ * :  :H"瀢 Hh:  _ *_א w?H ?H Z r 'o?H Z_@h_ * :  :H瀢 Hh?'(#8] "@: wh?H ?H Z r_א w/ǐ"c ] @ H  @.'?H Z_@h2_ * :  :H+瀢 Hh%_ * :  Hh:  _ *_א w?H ?H Z r 'o?H Z_@h _ * :  :Hh ?'(#8] "@h:  *??H ?H Z r_א wא  @'?H Z_@h2_ * :  :H+瀢 Hh%_ * :  Hh:  _ *_א w?H ?H Z r 'o?H Z_@h _ * :  :Hh ?'(#8] "@h:  *??H ?H Z r_א wא_  @T'?H Z_@h2_ * :  :H+瀢 Hh%_ * :  Hh:  _ *p_א w?H ?H Z r 'o?H Z_@h _ * :  :Hh ?'(#8] "@h<:  *?p?H ?H Z r_א w_ * : ' -H rHh_ /Oh ?'(#8] "@h _א w?H ?H Z r_ * : ' -H wHh_ /Ph ?'(#8] "@h_א w?H ?H Z r_ * : '  -H tHh_ /Qh ?'(#8] "@h_א w?H ?H Z r_ * :  H ?'(#8] "@h/R_א w?H ?H Z r?'"b] @〢 H〢 Hh ?'(#8] "@hm?X  "b ]  @ H_?P  "b ]  @ Hh ?'(#8] "@hDO"b(] @ H6?0 Z:   *0  "`?0 Z:   *0 ?X Zr?0 Z:   *0 ?P ZrhHO"b0] @\ H6?0 Z:   *0  "`?0 Z:   *0 ?X Zr?0 Z:   *0 ?P Zrh ?'(#8] "@h?0 Z@ O?0 Z "@o  @k'?H Z_@h2_ * :  :H+瀢 Hh%_ * :  Hh:  _ *_א w?H ?H Z r 'o?H Z_@h _ * :  :Hh ?'(#8] "@hS:  *??H ?H Z r_א w?`  @'?H Z_@h+_ * :  H$瀢/Hh?` : _ * _א w?H ?H Z r 'o?H Z_@h _ * :  Hh ?'(#8] "@h?` : *@?H ?H Z r_א wא"b8] @ H߀ Hh ?'(#8] "@h?8  @t?8 Z ?'(#8] "@h?8 Zߐ : @t ?8 ZZ  ?'(#8] "@h?8 Zߐ : Z` @??8 Zr?8 Z  @_?8 Z"`?8 Z?` ߕ: Z@J?0 ZZ P ?0 Z?8 ZrP?@ ?8 ZroT?@ Z?8 Zr?@ ?8 Zro=?H Z_@h ?'(#8] "@h'_?0 Zr: wh?0 Z?': w_ /Pw'_ ?'(#8] "@: wh-_w_  H_2 _ 2      @4_" _Z  __Z Z`@ \_r _r _@': w_ / w'_ ?'(#8] "@: wh-_w_  H_2 _ 2      @_" _Z  __Z Z`@ _r _r _@u': w_/Ȯwwww__ ?w(#8] "@_wh_w_2 ___ 2 _s Z[ __@ !w_w_/(wwww__ ?w(#8] "@_wh4_w_2 ___ 2 _s_s ZZ  _@ %w__@h_2 ___ 2  Z[ @ '뀢 H?w_w_/Fwwww'_@' H (#8] OH?wh| H_@@+w"b@] _@@' H?wh\""H]"bP] @w_ ?whL_@' H'h9 H?'h1""X]_@ O_@' H?'h__@ho_@Q_ h?'h__@T '_@: w_/w'w"#H] HH""`]"bP] @*w_;_@qwϒ_π h-_@w___ǐ@?w_ * :  H_*""]"bh] @""]@ H"#H] "@_@uw"#`]Z w""p]@w_ "#8] "@?wh"bx] _@"bP] @w_ "#8] "@?wh_@w_ h""]_ϔ @ Ho_@w___ǐ@?w_ * :  H_*_ϐ w_ * :  H_ * :  :Hh_א wo_ * :  :Ho_א w_@] @w_ _w_ h _Zw_@a_wo"#8] "@_@?whF_ _@D_?"`_?"` __r@_woy"#`]_r@_@"#`]Zw'_ h_ @_@ h_ _@t H 'h_Zwo: w_/c`w'?Ȑ r"#0]Z ""p]@"#0]r"#0]Z "#8] "@?wh`_ _ * :  /Hh?whP H "#(] Hh"#P]Z "#0] "b] Z@ @,w_w@o2 "b] _@@e2 ?А "b] @r!@'뀢 H (#8] Hh?А  "b]   @R!@'뀢 Hhx"#X]"b] @>"b] @6"#@]"b] @-"b] @7?Ȑ r?Ȑ Z "#X]@e"#X]*h@"#P]?Ȑ Zr"#P]Z"b] _@'"#P]Z@'ߡ: _@ h뀢 Hh"#P]Z@w"#P]r"#(] "@hwht"#0] "b] Z@@4''?H% Hh()! ] @I)! ]!@C"] _ @2'瀢 H @"#8] "@?wh4ˑ:  @J'ˀ@O H?wh:  ' H Hh wh  wh "#8] "@?w_P/֮,ww''_w_ '瀢 HhM ': O@\'瀢 H (#8] OHh8瀢 H_< @@H _< @ @Hh$: ה@%'瀢 Hh  8@ '_w_2 2  __ϖ @뀢 H_0/p("] Hwh.)!]Z  @&#X]Z  @"#] @x("]"("] H "#]@O?whw_@/x("] H ("]: @T /$w'뀢 H: wh1ߒ  @c @@w_ (#8] "@?wh("]: }@'뀢 H__r@h_@|: w_ /eww'ϒ !@('ϐϐ _!@P_w("]: }@': /=twww'wߐ  @'_w_wϐw("]: }@'__r@: 0/Ȑ'  @'("]: }@': /Pwww'''_ h (#8] "@?wh!' __@B_w'_''("]: }@G': w_/\www''''''_w_wǐw("]: }@'__r@: /ਐww''''''''_w_w("]: }@': /_www'_ h"#]_ @(#8] "@?wh__@_w'_w("]: } @': w_/%wwww'_ h"#]_ @(#8] "@?wh5 H2 "#] @(#8] "@_ "@?wh__@Z_w'_w_w("]: } @`': w_/Юwww''_ h"#]"c] _ @G(#8] "@?wh2_ "#]"c] @3(#8] "@?wh' __@_w'_w("]: } @ ': w_/zhww''_ h"#]"c] _ @(#8] "@?wh' __@_w'("]: } @': w_/;lww''''_ h"#]"c] _ @(#8] "@?wh ' __@~_w'''("]: } @': w_/Pwww''_w_wϐw("]: }@a'__r@: /Ϯἐww''_w_w("]: }@?': /@ww''''_w_w("]: }@': /www_r @w_ (#8] "@?wh+ '_w_@e'_wϐw("]: }@'뀢 H __r@__r@h_@^: w_/Gwww_r @sw_ (#8] "@?wh+ '_w_@'_wϐw("]: }@'뀢 H __r@__r@h_@: w_/ℐww'_r @,w_ (#8] "@?wh%'_wǐw("]: }@_'뀢 H __r@__r@h_@: w_/wwwww_r @w_ (#8] "@?whM_r @w_ _@(#8] "@?wh8 '_w_@'_ww_wϐw("]: }%@'뀢 H__r@__r@__r@__r@h_@p_@m: w_@ww_@` /Mw_w_@;'("]: }~@':  /1Dw''_w_@'("]: }@': /Ēwwww''' __@m_w'_ @/ `/ `/ `/ `/ `/ `/ `/_w_wǐw("]: }@`'__r@: /ήḔwww'''' __@)_w'_ @/ `/ `/ `/ `/ `/ `/ `/'_w_w("]: }@': /ഔwww'''' __@_w'_ @/ `/ `/ `/ `/ `/ `/ `/'("]: }@': /~Pwww''/' __@_w'_ @/ `/ `/ `/ `/ `/ `/ `//("]: }@': /~̒wwww''' __@o_w'_w_wϐw("]: }@s'__r@: /~www'''' __@<_w''_w_w("]: }@@': /~Dwww'''' __@ _w''_w_w("]: }@': /~www''_w_w_w("]: }@': /}_www''''_w_wϐw("]: }@'__r@: /}6Xwww'''' __@_w''_w_w("]: }@': @/}☔www'''' __@a_w''#/w'("]: }@g'뀢 HO__/r@_ "`_;"` __?r`_G"`_K"`_O"` _S"`$__r`(_W"`0__wr`8__or`@__"`H_c"`L_g"`P_k"`T__r`X__r``__r`h__r`p__r`x_["`__r`_ /   @: /}www'''' __@_w'_''("]: }@': 㾰/|Xwww''''__ __@_w''w_'_ '_ '_Z w_Z w_Z w_Z (w_Z 0w("]: _}@': /|Ȓwwww''' __@n_w'_w_w_wǐw("]: }@p'뀢 H_wwh: ww_w/|خwww'''' __@3_w''_w_w_wǐw("]: } @3'뀢 H_wwh: ww_w/|wwww''' __@_w'_w_w("]: }!@': /|n8wwww''' __@_w'_w_w_w_w("]: }"@': /{=tww''' __@_w'("]: }#@':  wwww_w__׀@h_w_w___@'뀢 H__@h__@h 'h?'': 0ww'_w_'_ @'_ @'_ @'_  '_  '6 0/{lww_ h)!]_Z@_@ H wh'_ h&#X]_Z@_@ Hwh_w_  H _  Hwh w_ /{ydwwww_w_  H (#8] "@?wh2_ h (#8] "@ wh% @w_ (#8] "@?wh___@_ߐ *`_r _r __r@_ r@w_/z,0wwwwwwo__@o (__@_w_w_w_wǐw("]: o}$@'__r@: 0/zdwwwww @%w_ (#8] "@?wh_  @__ @F__Zr`__Zr`_ *`__r@_ r@w_0/zwww @w_ (#8] "@?wh_  @t__ @_ *`__r@_ r@w_0/zwww_ h (#8] "@?wh _w__ @w_0/zqDwww_ h 1(#8] &@?wh _w__^ v@w_0/yRwww_ h 1(#8] &@?wh _w__^ v@w_0/y3Lww_w"#]@_"#]Z`@_"#h]Z`@_  : "#p]@_  : "#x]@_2 "#]@_ 2 "#]@0/yLw_w("]: }|@j': 0/yۮ''("]: }}@Q': 0/y®w_w("]: }z@9': 0/y(''("]: }{@ ': /ywww__@_w_w("]: }x@': /yp@ww'__@_w'("]: }y@': /xN㸒www''' __@_w'_w("]: }&@': /x$ww'''' __@_w''("]: }'@': /xdwwww''__@X_w''_w_w_w_wǐw("]: }(@V'뀢 H__r@: /xတwwww'' __@_w 0__@_w("]: })@"': /xwwwww_r @w_ (#8] "@?wh,__@_w_wǐw_w("]: }*@'뀢 H __r@__r@h_@a: w_ /wJ㨐''''("]: }+@':  /w-4w''_w("]: },@': 㾰/wĒwww''''o'so __@j_w'_w 0w2 _ߐJ@@$w_ (#8] "@?wghh2 _ߔJ@_ǒ @'@ Hh@2 *0_ w瀢 H_Z __Z@w_hw___wh_w?瀢 H__r@__ "` _ "`_ 2 _ w___Z@Z@ 'o2 _ߐJ@w_w("]: o}.@'_@: wg_gThere is no error message available for this thread.%x %XSBT-%d (%d) %s %s%s%sno timeThe NMO error message has been lost. Please set NSR_DEBUG_FILE and run NMO SBT-%d (%d) %s %s: NULL%s (%d:%d:%d)nwora_sbt_setup_error_filenmo.messages%s%c%s/tmp/nwora_sbt_free_sbtinfo2_memThere is no sbtinfo2() data cached.nwora_sbt_do_info2There is an invalid element in the name list: elem#(%d)The file name list is empty.nwora_sbt_get_lnm_ssinfoThe backup piece name is NULL.The save set could not be located: file name(%s): %sThe LNM ssinfo is NULL.nwora_sbt_idxrec_infonwora_sbt_ss_t_infonwora_sbt_vol_t_infotapenwora_sbt_add_sbtbfinfo_list_elemThe sbtbfinfo_list_t contains an empty element NULL.The sbtbfinfo_list_t is NULL.nwora_sbt_init_globalsThe function sbtinit2() has already been called.NSR_DEBUG_FILENSR_DPRINTF_FILENSR_DEBUG_LEVELnwora_sbt_index_createNSR_CLIENTNSR_SERVERNSR_FXBUSY_RETRIESNSR_MMDB_RETRY_TIME%s: Invalid value for the NSR_MMDB_RETRY_TIME varaible. Setting the retry time to 0.The NSR server name could not be determined.The NSR client name could not be determined. (0x%p) initialized: %d appID: %lu debug_file_name: %sNULL debug_file_logger: 0x%p debug_file_level: %d trace_file_name: %s trace_file_logger: 0x%p trace_level: %d default_error_file: %s mmdb_retry_secs: %d default_error_logger: 0x%p cfx_retries: %d type: %d value: %s value: %lu NULL NULLnwora_sbt_initThe functions sbtinit() or sbtinit2() have not been called.The Oracle context is NULL.nwora_sbt_authnsrstat>2/ $#Yڌ13qMm|ρUO/LߓvgV~nsrtypeNSR licenselicense typeexpiration datenwora_session_initThe backup file name is invalid.The block size is invalid: %luNSR_DMO_BENCHMARK_1The NSR_DMO_BENCHMARK_1 parameter is no longer supported.NSR_CLIENTNSR_SERVERNSR_SAVESET_NAMERMAN:%s: Using the save set name: %s%s: Using the NW server '%s'.%s: Using the block size '%lu'.%s: Using the NW client '%s'.%s: Using the backup file name '%s'.%s: Using the NW application ID '%lu'.The RMAN prefix 'RMAN:' must not contain lower case characters: %sThe NSR_SERVER parameter was not set.The NSR_CLIENT parameter was not set.The NWORA environment has not been initialized.The NWORA session is not in the NWORA_SESS_CREATED state: %dThe NWORA session handle is NULL.nwora_open_backup%s%s: The current time is: %luNSR_NO_MULTIPLEX%s: NSR_NO_MULTIPLEX set to: %sNSR_GROUPgroupsNSR_DATA_VOLUME_POOLThe NSR pool settings: copy number: %d pool: %sNSR_DATA_VOLUME_POOL%c is not set.volume poolNSR_NO_BUSY_ERRORStrueNSR_COMPRESSIONNSR_ENCRYPTIONNSR_CHECKSUMNULLNSR_DATA_VOLUME_POOL1NSR_DATA_VOLUME_POOL2NSR_DATA_VOLUME_POOL3%s: Turning off multiplexing.hard session limit1The SS browse time is not in the future: current time: %lu browse: %lu)The SS retention time is not in the future: current time: %lu retention: %lu)The current time could not be obtained (%d).The NWORA session is not in the NWORA_SESS_INIT state: %dnwora_sess_open_restore%s: Restore instigated by the user name: %s%s: We are restoring a Stream Old Version 2%s: The backup file was located: %sNSR_RESTORE_STDIO%s: A NW restore session was started with: %s%s: Using NSR_RESTORE_STDIO_PATH.NSR_RESTORE_STDIO_PATHnwora_sess_closerestoresave (0x%p) state: %d scheduled: %d backup_file_name: %s save_set_name: %s block_size: %lu appID: %lu corrupt: %d sfhead: 0x%p server: %s client: %s mode: %d ctxs: 0x%p logger: 0x%p NULLWARNING: An open NWORA session is being destroyed without being closed.nwora_sess_checkThe NWORA session is open but the NW session has not been set.The NWORA session is open but the NW stream has not been set.The NW client has not been set.The NW server has not been set.The NWORA session mode is set but the handle is not opened.nwora_sess_write_sfheadThe LNM stream has not been created.nwora_sess_read_sfheadNSR_STREAM_TYPEThe NSR_STREAM_TYPE was set to: %sv2oSetting the flag so the old prologue will be consumed.The old prologue will be consumed.The save stream is Stream Version 1The save stream is Stream Version 3The save stream is Stream New Version 2The save stream is Stream Old Version 2nwora_sess_consume_old_prologueCould not decode the 'sf_check' value: xdrs = 0x%pCould not decode the 'sf_magic' value: xdrs = 0x%pCould not decode the 'sf_more' flag: xdrs = 0x%pThe NWORA session has not been opened.The NWORA session is not in restore mode.nwora_build_sfhead%s: The encoded UNIX attributes: size=%d%s: Encoded the save file headerThe NWORA file ID could not be XDR'd. xdrm: 0x%p NWORA fid: 0x%p ssid: 0x%p ssoff: 0x%pThe UNIX attributes exceed the maximum size: %dThe UNIX attributes could not be XDR'd. xdrm: 0x%p ua: 0x%pnwora_env_initNSR_SERVERNSR_CLIENTNSR_GROUPNSR_DATA_VOLUME_POOLNSR_DATA_VOLUME_POOL1NSR_DATA_VOLUME_POOL2NSR_DATA_VOLUME_POOL3NSR_NO_BUSY_ERRORSNSR_COMPRESSIONNSR_CHECKSUMNSR_ENCRYPTIONNSR_DEBUG_FILENSR_DMO_BENCHMARK_1NSR_DEBUG_LEVELNSR_NWPATHNSR_STREAM_TYPENSR_NMSAPNSR_SAVESET_NAMENSR_MMDB_RETRY_TIMENSR_NO_MULTIPLEXNSR_RETENTION_DISABLEDNSR_NWORAPC_ND_RESTORENSR_NO_RELOCATIONNSR_PROXY_PFILENSR_PB_SERVICENSR_DPRINTF_FILENSR_SERVER_NICnwora_env_setoptThe NSR_SERVER=%s was ignored because NSR_SERVER_NIC was set.Setting: %s = %sUser NSR_SERVER settings are ignored in favour of savegrp settings: %ssavegrp_snapshotUser NSR_CLIENT settings are ignored during proxy copy operations: %sThe NSR_SERVER value was overwritten with the NSR_SERVER_NIC value %snwora_env_setopt_with_string,Environment variable %s=%snwora_env_read_parameter_filerThe parameter file name is NULL.%s: Reading configuration file:%s The parameter file can not be open:%snwora_env_set_browse_and_retentionNSR_SAVESET_RETENTIONNSR_SAVESET_BROWSEtrue%s: NetWorker browse and retention policies disabled.%s: Invalid retention policy: %s: %luInvalid browse and retention policies. Values Ignored.Invalid retention policy: %s. Value Ignored.%s: Invalid browse policy: %s: %luInvalid browse policy %s. Value Ignored.%s: Ignoring %s=%sforever%s=%snwora_env_find_in_nwpath%s: The requested file name was NULL.%s: Could not find the NWPATH.%s: Returning the path %s%s: Could not find file. (0x%p) NAME=%s VALUE=%s logger: 0x%p NULLnwora_env_checkThe NWORA environment handle is NULL.nwora_env_client_and_server%s: The client name is %sThe name of the NSR server could not be determined.%s: Invalid server name - %sNULL%s: The NSR_CLIENT is set to %s%s: Obtaining canonical client name from server.%s: The NSR_SERVER is set to %s%s: Invalid canonical name - %s. Falling back to local host.%s: Using the canonical client name %s%s: Invalid NSR_CLIENT value - %sThe name of the NSR client could not be determined.%s: Invalid client name - %snwora_env_getservernwora_getserver: reading %s environment variable%s: %s is not set. Searching for NetWorker server...%s: using NetWorker server %snwora_getserver: server not foundnwora_getserver: client name is NULLnwora_get_nwpath%s: Using ENV path %s.%s: Using file path %s.%s: Could not get NW path.%s: Using default path %s.A+~Raf>94CvPj>гnwora_sbt_removeNSR_CATALOG_SYNCH%s: We are doing a catalog synchronization.NSR_CLIENTNSR_SERVER%s could not find backup file %s on server %s%s: removing saveset %s.NSR_CATALOG_SYNCH_FILE%s: Logging backup piece name '%s' to the file '%s'.%s%s: The backup piece name '%s' could not be logged to file '%s'.%s: The catalog synchronization file was not set.The backup piece name list is NULL.nwora_sbt_remove_magic1_SS%s: Exiting with error - %s%s: Removing the meta data save set '%s'%s: Removing the data save set '%s'The SS info is NULL.nwora_sbt_remove_magic2_SS%s: Removing the SSID '%s'nsrsnapck-dy-S-x-sNULL%s process failed with error - %sThe NSR server name could not be determined.Could not find the %s binary.nworapc_sess_initNSR_SAVESET_NAMENSR_PROXY_PFILEThe NSR_PROXY_PFILE parameter was not set.oracleApplication_modeRMAN:The RMAN prefix 'RMAN:' must not contain lower case characters: %sThe NWORAPC session is not in the uninitialized state. It cannot be initialized: %dThe BRC API operation specified is invalid: %dThe NWORAPC session handle is NULL.nworapc_sess_open_backupThe NWORAPC session is not in the initialize state. It cannot be opened: %dNSR_BACKUP_LEVELfull%s: %snworapc_sess_open_restoreRESTORE_TYPE_ORDERforceNSR_PLATFORM_NAMESPACErollbackForced rollbacks are not supported. Please change the RESTORE_TYPE_ORDER settings.nworapc_sess_add_sbtpc_objectThe OS file name has been specified multiple times by Oracle: %sThe SBTPC object has been initialized for a type %d operation and the NWORAPC session has been initialized for a type %d operation.The NWORAPC session is not in the open state. SBTPC objects cannot be added to the session: %dThe SBTPC object is NULL.nworapc_sess_get_object_by_nameThere was no 'sbtpcquery' call for object: %sThe sbtpc_object_pp pointer is NULL.nworapc_sess_get_object_by_idThere was no 'sbtpcquery' call for object: %dnworapc_sess_check_backup_name_collisionThe backup piece name of the object is NULL.This backup piece name is already used in the SBTPC session: %snworapc_sess_add_pb_object_tCannot insert %s(id: %d) into BRC object list. Object with the same BRC ID already exists: %s(id: %d)The BRC object is NULL.nworapc_sess_remove_sbtpc_objectThe SBTPC object to be removed is not on the list.The following SBTPC object was removed from the NWORAPC session:The SBTPC object pointer is NULL.nworapc_sess_sbtpcvalidatesavegrp_snapshotRemoving SBTPC object from the NWORAPC session.Either sbtpcbackup() or sbtpcrestore() was not called for the object.%s: Calling pb_open() (%d).%s: pb_open() returned success.%s: Calling pb_environment().The call to pb_environment() failed with error: %sThe call to pb_environment() failed with error: %sThe BRC environment:%s: Calling pb_prepare() for all objects...%s: pb_prepare() returned success()%s: The call to pb_prepare() failed with error: %sThe call to pb_prepare() failed with error: %s%s: The call to pb_open() failed with error: %s The call to pb_open() failed with error: %sNULLFinding savegrp communication log...%s%c%saThe nsrnmostart log file '%s' was opened succesffully.Proxy session started The nsrnmostart log file '%s' could not be opened (%d).The nsrnmostart log file '%s' could not be opened.%s: Backup is not started by Snapshot savegrp.nowrapc_sess_sbtpcstatusThere are no SBTPC objects that have not returned their status. The SBTPC object '%s' is in an invalid state: %dnworapc_sess_sbtpcend%s: The SBTPC object could not be closed: %s %sThe pb_postpare() operations have been waited for. (0x%p) op: %d state: %d brc_handle: 0x%p server: %s client: %s sbtpc_object_list_head: 0x%p sbtpc_object_list_end: 0x%p pb_object_head: NULL logger: 0x%p) (0x%p) current_object_id: %lu NULLnworapc_sess_checkThe NW server is set to NULL.The NW client is set to NULL.The NWORAPC session environment was not set.The NWORAPC session type is invalid: %dThe NWORAPC session has not been initialized.nworapc_sess_check_licenseauth indexauth index preferred versionauth modebrowsensrindexdA+~Raf>94CvPj>гThe NW server does not have a valid NMO proxy copy license.nworapc_sess_brc_init%s: Calling pb_version().%s: The pb_version() call failed with: %d%s: pb_version returned version range: %d - %d%s: Calling pb_init()%s: pb_init() failed with (%d)pb_init() failed with: %d%s: pb_init() failed with (%d): invalid BRCAPI versionpb_init() failed with (%d): invalid BRCAPI versionThe NMO BRCAPI version %d is outside the range supported by the BRC service: %d - %dsbtpc_object_sbtpccancel%s: Calling pb_cancel() for object %s.NULLpb_cancel() returned success.%s: The pb_cancel() call for object '%s' returned the error message: %sThe pb_cancel() call for object '%s' returned the error message: %ssbtpc_object_sbtpcvalidateThe SBTPC object is not in the PB_TYPE_PREPARE state: %sThe SBTPC object is not in the SBTPCSTATUS_NOTREADY state: %ssbtpc_object_sbtpcstartsbtpc_object_sbtpcstatus%s: Calling pb_status() for object %s for pb_type %d.%s: pb_status() for object %s is %d.The SBTPC object '%s' failed with the error message: %s%s: File %s returned error state.The BRC API did not return an error string for the SBTPC object: %s%s: pb_inquiry() is failed to inquire error for '%s' because: %sThe pb_inquiry() for object '%s' failed because: %s%s: File %s returned aborted state.The SBTPC object '%s' was aborted by the BRC service. Please check the PowerSnap logs for an explanation.%s: object %s with status %d completed pb_type %d.%s: object %s with status %d now has pb_type %d.%s: Completing recover work...%s: Completing save work...%s: pb_status() failed for object %s with pb_type %d: %sThe call to pb_status() for object '%s'failed with error: %s (0x%p) object_id: %lu os_file_name: %s backup_file_name: %s os_reserved_size: %lu platform_reserved_size: %lu block_size: %lu canonical_os_file_name: %s oracle_SID: %s data_source_name: %s data_source_type: %d pb_objectlist_p: NULL logical_pb_objects: NULL all_pb_objects.pb_object.next: 0x%p all_pb_objects.pb_object.pb_object: 0x%p meta: 0x%pTRUEFALSE rollback_requested: %s relocation: %s destructive: %s file_type: %d original_file_location: %s restore_staging_dir: %s restore_file_in_staging_dir: %s op: %d pb_type: %d fully_initialized: %s fully_finished: %s status_returned: %s sbptc_status: %d error: NULL error: %s next: 0x%p nworapc_object_id: 0x%p logger: 0x%p NULLsbtpc_object_checkThe SBTPC object OS file name is NULLThe SBTPC object backup file name is NULL.The SBTPC object canonical OS file name is NULL.The NWORAPC object generator has not been initialized.The BRC API session has not been opened.The SBTPC object does not have an initialized PB object.The SBTPC object meta data is NULL.The SBTPC object handle is NULLsbtpc_object_set_status%s: Object has: PB_TYPE: %d Oracle status: %d Oracle type: %d%s: Invalid SBT function index.%s: State of object on exiting - %dThe SBTPC object '%s' is entering the SBTPCSTART restore state but its BRC type is: %dThe SBTPC object '%s' is entering the SBTPCSTART backup state but its BRC type is: %dThe SBTPC object '%s' is entering the SBTPCSTART state but its status is: %dThe SBTPC object '%s' is leaving the BRC save state but its status is: %dThe SBTPC object '%s' is leaving the BRC snapshot state but its status is: %dThe SBTPC object '%s' is leaving the BRC prepare state but its status is: %d%s: Can not overwrite ERROR status.The SBTPC object already has an error status.sbtpc_object_set_errorThe SBTPC object '%s' failed with the status '%d', the pb_type '%d' and the error: %ssbtpc_object_pb_inquiry%s: Calling pb_inquiry() for object %s.%s: pb_inquiry() returned success.%s: The result is %sCan not backup object %s with proxy copy.The pb_inquiry() of object '%s' returned error: %ssbtpc_object_sbtpcquerybackupThe SBTPC object has already been initialized.The BRC API handle has not been initialized by the NWORAPC session.The SBTPC object handle is NULL.sbtpc_object_sbtpcbackup%ludata sizestart sizeheader sizedirectiveThe rawasm directive could not be created.The SBTPC object's meta data is NULL.sbtpc_object_get_backup_metadataNULL%s: Regular source - %sThe data source is neither a file or a RAW volume - %s%s: Raw source - %ssbtpc_object_finalize_metadataobject metadata%uobject metadata type%s: Creating BRC logical object(s)The pb_inquiry() called failed for object '%s': %ssbtpc_object_create_logical_pb_objects<%s%s%d%s>sbtpc_object_pb_save%s: Calling pb_save() for object %s.%s: pb_save() call succeeded.The pb_save() of object '%s' returned error: %ssbtpc_object_sbtpcstart_backup%s: Calling pb_snapshot() for object %s.%s: pb_snapshot() returned success.The pb_snapshot() call for object '%s' failed with error: %ssbtpc_object_post_pb_saveThe call to pb_status() failed for object '%s' with the error: %s%s: Calling pb_status() for logical object %s%s: %s%s: Logical object '%s' saved successfully%s: Logical object %s has invalid state: %dThe BRC status of logical object '%s' was failure: %d%s: Calling pb_postpare().%s: The call to pb_postpare() failed for SBTPC object '%s' with error: %s%s: pb_postpare() was successfully called.sbtpc_object_sbtpcqueryrestoresavetimeThe SBTPC object could not determine the destination of the restore.A rollback is not possible when doing relocation during a restore. Please remove 'rollback' from the RESTORE_TYPE_ORDER parameter or do not request relocation.The SBTPC object handle is NULL.sbtpc_object_sbtpcrestore%lustart sizesbtpc_object_sbtpcstart_restoreNULL%s: Starting recover of %s%s: Calling pb_restore() for object %s.%s: pb_restore() returned success.The pb_restore() for object '%s' failed with error: %sThere is a problem with the meta data. Error: %s%s:The file '%s' cannot be removed (%d).sbtpc_object_set_up_restore_paths%s: The restore destination name is '%s'.Attempted to restore raw device '%s' to file '%s'.Attempted to restore file '%s' to raw device '%s'.The canonical OS file name path is invalid: %ssbtpc_object_set_up_staging.nworapc%s: The staging directory is - %sThe file '%s' cannot be removed from the staging directory (%d).The staging directory '%s' has invalid permissions (%d).Error creating staging directory '%s'.The restore destination path is not valid: %ssbtpc_object_set_up_raw_file_nameThe destination does not have the same terminating name as the source '%s'.Could not determine the terminating name of '%s'.sbtpc_object_post_pb_restore%s: Calling pb_postpare() for object %s%s: pb_postpare() returned success.%s: Call to pb_postpare() for object %s failed.sbtpc_object_restore_rename%s: About to rename %s to %s%s: The relocate succeeded.The restore operation for the file failed for an unknown reason: %s%s: Could not rename file - %s to %s (%d)%s: The file '%s' was not found in the staging directory.The file is not in the staging directory and a rollback was requested. We are assuming a rollback was performed and there is no need for relocation.The file being recovered could not be found in its staging location: %s%s: Recovering raw device.NSR_DEBUG_FILE4.2%s v%sNetWorker Module for Oracle%sEntering sbtinit()sbtinit: bs=%p, in=%p, out=%pnsrNMO v%s%s: API Version: %lusbtinit%s: MMS Description: %s%s: Context size: %lu%s: NWORA version: %lu%s: NWORA proxy limit: %luLeaving sbtinit (0)The trace file name is: %ssbtbackupEntering sbtbackup()file name = %sblock_size = %d, max size = %dcopy # = %u, media pool = %uctx = 0x%p, flags = %lu, file name = %s file info = 0x%p, block_size = %d, max size = %d copy # = %u, media pool = %uLeaving sbtbackup (%d)The backup file already exists: %sA backup or restore session is already in progress.Oracle pools are not supportedEntering sbtclose2()ctx = 0x%p, flags = %luLeaving sbtclose2 (%d)sbtcommandNSR_ENVEntering sbtcommand()ctx = 0x%p, flags = %lu, cmd = %s%s Warning: Null commandThe command string is: %sLeaving sbtcommand (%d)Null command for %s%s Warning: statement '%s' not processed. Invalid KEY word.Invalid KEY wordtest sbtcommand string%s Warning: test sbtcommand string, ignored%s: '%s' should be in format: KEY=(xxxxx)'%s' should be in format: KEY=(xxxxx)Entering sbtend()Entering sbterror()Returning the error code: %luReturning the error message: %sNULLNo error code was set.error code not set, sbterror() calledLeaving sbterror (%d)sbtinfo2Entering sbtinfo2()ctx = 0x%p, flags = %lu, sbtbfinfo = 0x%p%sLeaving sbtinfo2 (%d)name = %sTotal # of info fields = %dUnknown info type %luSTREAMPROXYmethod = %scretime = %luexptime = %luexptime = %sforeverlabel = %sSINGLEMULTIPLEshare = %sSEQUENTIALRANDOMorder = %sNot foundThe file name list is NULL.The backup info return pointer is NULL.sbtinit2Oracle API version = %lXLeaving sbtinit2 (0)Entering sbtinit2()The Oracle context is NULL.sbtread2Entering sbtread2()sbtread2 entry buffer = %ssbtread2 exit buffer = %sLeaving sbtread2 (%d)The NWORA session has not been initialized.Entering sbtremove2()Leaving sbtremove2(%d)sbtrestoreEntering sbtrestore()block size = %d, file name = %sctx = 0x%p, flags = %lu, block size = %d file name = %sLeaving sbtrestore (%d)sbtwrite2Entering sbtwrite2()ctx = 0x%p, flags = %lu, buf = %sLeaving sbtwrite2 (%d)sbtpcquerybackupEntering sbtpcquerybackup()ctx = 0x%p, flags = %luos filename : %sctx = 0x%p, flags = %lu os file name = %sNSR_SERVERNSR_CLIENTLeaving sbtpcquerybackup (%d)The NSR client name could not be determined.The NSR server name could not be determined.Proxy copy is not supportedsbtpcbackupEntering sbtpcbackup()ctx = 0x%p, flags = %lu, handle pointer = 0x%pbackup file name: %sos file name: %sfile info = 0x%p, os reserved size = %luplatform reserved size = %lu, block size = %lu, media pool %uctx = 0x%p, flags = %lu, handle pointer = 0x%p backup file name = %s os file name = %s file info = 0x%p, os reserved size = %lu platform reserved size = %lu, block size = %lu, media pool = %uLeaving sbtpcbackup (%d)Leaving sbtbackup (%d)NSR_ORACLECAT_MODEThe NWORA resource lock file does not exist. Please create it by running 'nsrnmoadmin -r list'ORACLE_SIDundetermined%s: Using ORACLE_SID: %sThe ORACLE_SID must be set when performing proxy copy backups.The NWORA resource NSR_ORACLECAT_MODE is in the 'undetermined' state.Could not obtain NSR_ORACLECAT_MODE from NWORA resource file.The NWORA resource file does not exist. Please create it with nsrnmoadmin.An NWORA resource file handle could not be allocated.Backup file %s already exists: ssid %sThe NWORAPC session has not been initialized.Entering sbtpccancel()ctx = 0x%p, flags = %lu, handle = %luLeaving sbtpccancel (%d)sbtpccommitEntering sbtpccommit()Leaving sbtpccommit (%d)%s: In sbtpccommit() for file %s with status %dThe sbtpccommit() function was called during restore.The sbtpccommit() function wsa called during restore.Entering sbtpcend()Leaving sbtpcend (%d)sbtpcqueryrestoreEntering sbtpcqueryrestore()os filename: %sctx = 0x%p, flags = %lu, backup file name = %s os file name = %sLeaving sbtpcqueryrestore (%d)NSR_NWORAPC_ND_RESTOREfalsesbtpcrestoreEntering sbtpcrestore()os reserved size = %luctx = 0x%p, flags = %lu, handle pointer = 0x%p, backup file name = %s, os file name = %s, os reserved size = %luLeaving sbtpcrestore (%d)%s: BRC object for %s:Entering sbtpcstart()ctx = 0x%p, flags = %lu, handle = %lu, file size = %luLeaving sbtpcstart (%d)Called for object %ssbtpcstatusEntering sbtpcstatus()handle pointer = 0x%p, file status = 0x%pctx = 0x%p, flags = %lu, handle = %lu, handle pointer = 0x%p, file status = 0x%p%s: Status without waitLeaving sbtpcstatus (%d)Status with waitEntering sbtpcvalidate()Entering sbtpcvalidateLeaving sbtpcvalidate (%d)lnm_buffer_addThe 'list' is NULL.lnm_buffer_splitThe split size was specified as 0.The length of the buffer to split was specified as 0.The buffer to split contains no data. The pointer used to return the buffers is NULL.lnm_buffer_joinThe buffers to join contain no data. There is no more memory available.lnm_index_set_cfx_retriesSetting the CFX retries to: %dSetting the MMDB retry seconds to: %dlnm_index_lookup%s: %sThe index_lookup() failed with the error: %sThe MMDB lookup failed the cross check. The MMDB may be missing the entry or the NSR_CLIENT may be set to an alias that is failing. Please ensure the NSR_CLIENT name matches the name used in the NSR_CLIENT resource:CFX file name(%s) save_time(%lu)The MMDB lookup failed the cross check. The MMDB may be missing the entry or NSR_CLIENT may be set to an alias that is failing. Please ensure the NSR_CLIENT name matches the name used in the NSR_CLIENT resource: CFX file name(%s) save_time(%lu)NULLThe CFX lookup failed the cross check: CFX file name(%s) save_time(%lu)The LNM SS info pointer is NULL.lnm_index_cfx_lookup%s: Performing the NW client index lookup on: name: %s time: %lu%s: %d records returned.Could not locate the LNM save file '%s' on server '%s'.The lookup of '%s' on server '%s' failed - '%s'(no reason available)lnm_index_cfx_lookup6 time low: %lu time high: %lulnm_index_ss_t_lookup%s: Making the NW MMDB connections.%s: Fetching the SS with time '%lu'.Error in mmdb lookup by time: %sThe output parameter 'ssinfo' is NULL.lnm_index_vol_t_lookup%s: Getting the volume information.Error in MMDB lookup for volume: %s%s%s' privilegeMonitor NetWorker%s: Fetching...Operate devices and jukeboxesA volume query cannot be completed before an ss_t query.The output parameter 'ssinfopp' is NULL.lnm_index_remove_SSID/tmp.nwidx.lckThe removal of SSID '%s' failed with error: %s'Could not lock '%s' for index deletion. There were %d attempts. (%d)Could not create the LNM index lock file '%s' (%d) (0x%p) NULL server: %s client: %s cfx_session: 0x%p cfx_CLIENT: 0x%p cfx_retries: %d name_space: %lu mmdb_connect: %d mmdb_connect: %d logger: 0x%plnm_index_checkThe LNM index client has not been set.The LNM index server has not been set.The LNM index handle has not been allocated.lnm_index_cfx_connect%s: Creating CFX connections: server('%s') client('%s') retries (%d)%s: The CFX connection has already been created.%s: Starting the connection to the NW client indexes.lnm_index_cfx_pconn%s: Getting the LGTO parameters for server '%s' and client '%s'.auth modebrowsensrstatauth indexauth index preferred version%s: Getting the LGTO authentication from server '%s'.nsrindexd%s: Getting the NW index connection.Exceeded the number of retries. The NetWorker server may be down or unreachable.Exceeded the number of retries. The NetWorker server may be down or unreachable.lnm_index_cfx_start%s: Starting the NW index connection with sever '%s' and client '%s'.Exceeded the number of retries.lnm_index_mmdb_connect%s: Setting the MMDB connection for server '%s'.lnm_index_evaluate_cfx_lookup_results%s: A suitable record has been found.Could not locate the LNM save time '%lu' on server '%s'.The record obtained has the wrong save time '%lu'. The save time queried was '%lu'.A connection to NW server '%s' could not be established because '%s'.The NW authentication for client '%s' was refused by server '%s' because '%s'.lnm_stream_backup_initThe stream is not in the LNM_STREAM_INIT state: %dlnm_stream_restore_initThe function nsr_bind_recov_mm() failed with the error: %sThe function mm_retrieve() failed with the error: %sThe function nsr_rstart() failed.The function nsr_rstart() failed with the error: %slnm_stream_file_restore_initr%s%c%sThe saveset file could not be opened: %slnm_stream_write_sfheadThe LNM stream is not open for writing: %dThe sfhead could not be XDR'd.The stream is not in the LNM_STREAM_OPEN state: %dlnm_stream_read_sfheadThe LNM stream is not open for reading: %dlnm_stream_write%s: Entering.%s: Exiting with error: %sasdf_output_section1() failed xdr=0x%p: bp=0x%p: send_len=%d: type=%lu: fhand=0x%p: wrapper=0x%p: directp=0x%pThe data to write is larger than the ASDF buffer allocated: %d, %dThe stream is not in the LNM_STREAM_SFHEAD_WRITTEN state: %dlnm_stream_end_fileThe savefile_fini() call failed.lnm_stream_fill_buffer%s: Exiting.The EOF has been reached.The stream is not in the LNM_STREAM_SFHEAD_READ state: %dlnm_stream_readlnm_stream_close (0x%p) mode: %d state: 0x%x XDR: 0x%p f { fd: %d retcode: %d bucketless: %d } compression: %d encryption: %d crc: %d asdf_type: %d asdf_header: 0x%p asdf_buf_header: 0x%p asdf_buf: 0x%p save_time: %lu eof: %d use_asdf: %d runcount: %lu cache: 0x%p cache_ptr: 0x%p cbytes: %lu logger: 0x%p NULL%slnm_stream_checkThe LNM stream mode is not valid: %dThe LNM stream handle is NULL.lnm_stream_close_mmd_restorelnm_stream_asdf_readThe ASDF body could not be unwrapped.asdf_read_section() failed xdrs: 0x%p, f->bucketless: %d, header: 0x%p, asm_t_varp->Buf1allocp: 0x%p, bp: 0x%p, asm_t_varp->Buf1len: 0x%ullnm_stream_bucket_restoreThe data could not be XDR'd from the stream.The 'more' flag could not be XDR'd from the stream.alnm_allocThe 'buffer' pointer is NULL.lnm_get_client_attrsversionLNMs_2004.Build.273archkernel archCPU typemachine typeOSNetWorker versionclient OS type%dCPUsdisks%luIP addressMB used0physical hostnameInvalid attribute listInvalide attribute liststdoutstderrStarted logging to %s (TIME UNKNOWN) %x %X(date = %s) (pid = %d) TIME UNKNOWN: NULL FUNC NAME%s: Entering.%s: Entering. %s: Exiting with an error.%s: Exiting with error:%sNULL%s: Exiting. %s: Exiting.lnm_logger_checkThe LNM logger handle is NULL.lnm_logger_get_log_fileThe log file stream could not be obtained.The log file could not be locked: %sThe log file could not be created: %slnm_open_backup_nw_sessThe LNM NW session handle has already been opened.The save set name is NULL.The server version does not accept client file index hintsCannot enable file index optimization (%s)%s: Cannot enable file index optimization (%s)lnm_open_restore_nw_sessThe user name is NULL.lnm_nw_sess_closeThe LNM NW session is already closed in mode: %dThe function nsr_end() failed with the error message: %s (0x%p) NULL open: %d server: %sNULL client: %s name_space: %lu mode: %d retries: %d timeout: %lu backup_info: NULL ss_name: %s browse: %lu savetime: %lu expiry: %lu level: %d NAME=%s VALUE=%s size: %lu restore_info: NULL restore_user: %s logger: 0x%p%slnm_nw_sess_checkThe NW server name is NULL.The NW client name is NULL.The NW session handle is initialized for backup during a restore.The NW session handle is initialized for restore during a backup.The 'mode' is invalid: %dThe NW session handle is NULL.The nsr_init() call failed with the error: %sThe nsr_start() call failed with the error: %slnm_nw_sess_server_initThe call to nsr_start() failed with the message: %sExceeded the number of retries for nsr_start(). The NetWorker server may be down or unreachable: %sDirect saves are not enabled.The call to nsr_init() failed with the message: %sExceeded the number of retries for nsr_init(). The NetWorker server may be down or unreachable: %sThe current time could not be obtained (%d).There is already a NW session opened by this thread.(undocumented errno %d)NSR_DEBUG_LEVEL%s%c%snmosbt.lognwora_check_path%s: The path is empty.%s: The path is larger than %d characters.%s: Path element %s rejected because it does not start with a %c.%s: Path element rejected because it larger than %d.:%s: Using path %s.%s: No suitable path elements were found.nwora_default_nwpath%s: The default NWPATH is too large.%s: The NWPATH is %s.nwora_file_nwpathNSR_NWPATH%s: Could not find NSR_NWPATH in the NWORA resource file.%s: Could not find valid NSR_NWPATH in file.%s: %s%s: Could not allocate a NWORA resource file handle.nwora_find_in_path%s: The path is NULL.%s: The file name is NULL.%s: The path or the file name exceed the maximum allowed.%s: Could not find the file %s in the path %s.%s: Returning the path %s.nworapc_get_file_typeThe object '%s' is not a file.The type handle is NULL.The OS file name is NULL.nwora_expand_symbolic_linkCould not read link - %sInvalid source path argumentnworapc_device_file_lstat/devicesCould not lstat secondary link - %sCould not lstat - %s<< %s >> rawasm -o%lu|%lu|%lu: %s nwora_fullpathCannot obtain full path for %sInvalid output path argument.The BRC API error could not be obtained. The call to pb_error() failed for unknown reasons.nworapc_check_path_lenEmpty pathPath %s is too long.nworapc_pb_attrlist_addAttribute %s already existsInvalid argumentnwora.resnwora.res.lcknwora_validate_res_filenwora_update_res_file%s: Adding new resources...%s: Writing out the NWORA resource file image.The list of new NWORA resources is empty.nwora_get_resource_from_res_file%s: Getting the resource '%s' of type '%d' from the list.NULLThe NWORA resource return container is NULL.The NWORA resource parameters are NULL.nwora_get_resources_from_res_file%s: Getting the resources.%s: Obtained the resources.nwora_delete_resource_from_res_file%s: Deleting resource '%s' of type '%d' from list.%s: Writing NWORA resource file image.nwora_update_SID_in_res_file%s: Setting SID resource: SID: %s Oracle Home: %s TNS Path: %s Library Path: %s Connection File Path: %sNSR_ORACLE_CONNECT_FILENSR_ORACLE_LIB_PATHNSR_ORACLE_TNS_ADMINNSR_ORACLE_HOMENSR_ORACLE_SID%s: Setting the NWORA resource.# # This resource lists the Oracle information that describes # a single ORACLE_SID # %s: Updating the NWORA resource file.The NWORA resource could not be allocated.The values ORACLE_SID, ORACLE_HOME, and NWORA_CONNECT_FILE must be set.nwora_get_res_file_type_and_commentNSR_NWPATH# # NSR_NWPATH is set to the NetWorker Client directory # NSR_ORACLECAT_MODENSR_REMOVE_ON_FAILURENSR_ORACLECAT_LOG_FILENSR_ORACLECAT_DEBUG_FILEThe NWORA resource type can not be determined.# # NSR_ORACLECAT_DEBUG_FILE is the debug log file for nsroraclecat when it # performs catalog synchronization. # # # NSR_ORACLECAT_LOG_FILE is the log file for nsroraclecat when it performs # catalog synchronization. # # # NSR_REMOVE_ON_FAILURE specifies if the NMO index entries should be # removed if catalog synchronization fails. It is set to FALSE by default. # # # NSR_ORACLECAT_MODE specifies if catalog synchronization is 'enabled' # or 'disabled'. It is set to 'undetermined' by default. It must be set # to either 'enabled' or 'disabled' by an administrator before proxy copy # backups may be performed. # The NWORA resource comment pointer is NULL.The NWORA resource type pointer is NULL.nwora_save_res_filesaveThe NSR_NWPATH resource has an empty value.The NWORA resource file could not be saved.The NWORA resource file could not be saved: %s.The NWORA resource file does not contain the NSR_NWPATH resource.nwora_res_file_existsThe NWORA resource file '%s' exists.The NWORA resource file '%s' does not exist.nwora_check_res_fileThe NWORA resource lock file name is NULL.The NWORA resource file name is NULL.The NWORA resource file handle has not been allocated.nwora_get_Default_resources%s: Creating the header.# /nsr/res/nwora.res # # This file is created by nsrnmoadmin. It contains # all the resources required by NMO. # %s: Creating the NSR_NWPATH.%s: Creating the NSR_ORACLECAT_MODE.undetermined%s: Creating the NSR_REMOVE_ON_FAILURE.FALSE%s: Creating the NSR_ORACLECAT_LOG_FILE.%s: Creating the NSR_ORACLECAT_DEBUG_FILE.The NWORA resource handle could not be allocated.nwora_read_res_file_image%s: Opening the NWORA resource file for reading.%sInvalid entry found on line %d of the NWORA resource file:%s: Obtained resource:nwora_write_res_file_imageThe first NWORA resource is not a header (%d).%s: Locking the NWORA resource file.nwora.res.bak%s: Renaming the NWORA resource file to '%s'.%s: Opening the resource file for writing.%s: Writing out resource:%s= %s: Removing '%s'Could not create NWORA resource backup file '%s'.You must be the super-user to update the NWORA resource file.nwora_open_res_fileInvalid NWORA resource file mode.%s: Creating the NWORA resource file.%s: Opening the NWORA resource file for writing.wCould not open resource file '%s' (%d).Could not create the NWORA resource file (%d)The NWORA resource file does not exist.%s: Removing the original NWORA resource file.rCould not unlink NWORA resource file (%d).The NWORA resource file mode is invalid.The NWORA resource file is already open.nwora_close_res_file%s: Closing the NWORA resource file.nwora_new_res_file%s: Getting the default NWORA resources.%s: Writing the default NWORA resources.nwora_get_res_file_lock%s: The NWORA resource file is already locked.%s: Checking to see if the lock file '%s' exists.%s: Locking file '%s'.%s: Creating the lock file '%s'.Could not open NWORA resource lock file '%s' (%d).Could not create the NWORA resource lock file (%d)nwora_release_res_file_lock%s: Releases the lock on '%s'.nwora_set_resourceInvalid NWORA resrouce type %dInvalid NWORA resource type %d%s: Setting a NWORA parameter resource.%s: The NWORA resource has been set to:%s: Setting a NWORA SID resource.%s: Setting a NWORA header resource.Attempted to set a NULL NWORA resource.nwora_get_resource_from_listThe NWORA resource parms are NULL.nwora_delete_resource_from_listThe NWORA resource does not exist.The NWORA list is empty.nwora_update_resource_list%s: Adding NWORA resource:%s: Dup'ing the NWORA resource.%s: Adding the NWORA resource to the front of the list.Could not duplicate NWORA resource.nwora_check_SID_resource_parmsThe NWORA resource parameter list for a SID requires the %s, %s and %s information.The NWORA resource parameter list contains the invalid element '%s'.The NWORA resource parameter list is empty.nwora_check_PARAM_resource_parmsTRUEdisabledenabled%s can only be set to 'enabled', 'disabled' or 'undetermined'.%s can only be set to 'TRUE' or 'FALSE'.The NWORA resource parameter list can only contain one entry.nwora_check_resourceThe NWORA resource does not have the comment field set.The NWORA resource has an empty parameter list.Invalid NWORA resource type (%d).The NWORA resource is NULL. type: %d %s=%sNullnwora_get_metadataThe NWORA meta data could not be encoded.The SBTPC_MAGIC1 meta data could not be encoded.Incorrect size of SBTPC metadata stored in saverec (size: %lu)The NWORA meta data is too small to contain the magic number.Cannot decode BRC metadataThe LNM ssinfo does not contain any meta data.The LNM ssinfo does not contain any no meta data.The LNM ssinfo does not contain any CFX informaiton.The LNM ssinfo handle is NULL.The NWORA index handle is NULL.nwora_allocate_magic1_metadataThe NWORA meta data pointer is NULL.nwora_allocate_magic2_metadatanwora_xdr_metadataThe NWORA meta data has an invalid magic number (%lu)The SBTPC_MAGIC2 meta data could not be encoded.nwora_common_metadataThe NWORA meta data magic number is invalid (%lu).nwora_check_metadataThe NWORA meta data magic is set but there is no data.The NWORA meta data is present when type is 'No Meta Data'.The NWORA meta data has an incorrect type '%d'.The NWORA meta data handle is NULL.nwora_assemble_metadata%s%s%d%s<>%s: Processing BRC logical object: %s.%d.%d.%d.%dnwora_validhost: hostname is NULLnwora_validhost: hostname %s is not a validnwora_delete_file%s: WARNING: File %s not deletedYou may want to delete itnwora_spawn_and_wait%s: Output of the command: %s%s: Killing process %d%s: Could not kill process %d. Check for zombies.%s: Error waiting for child %s.%s: Process %s exited with signal %d.%s: Process %s exited with error code (%d)%s: Could not spawn %s command%s: Could not create pipe.nwora_parse_name_val_token=%s: Warning: statement '%s' not processed. Correct format: var_name=value%s%s%sbytesKBs%s status: %ld file%s, %ld %s, %01lud:%02luh:%02lum:%02lus@(#) Module Name: NetWorker Module for Oracle@(#) Module Vers: 4.2tcppb_discover(): ENTRY pb_init(): retrying clnt_create() but sleeping for %d second NSR_SERVERnsrpsdpb_init(): nsr_server (lgto_auth server)=%s nullpb_init(): ENTRY pb_end(): ENTRY pb_inquiry(): ENTRY pb_open(): ENTRY pb_close(): ENTRY pb_environment(): ENTRY pb_prepare(): ENTRY pb_snapshot(): ENTRY pb_save(): ENTRY"%s" NULLpb_retrieve_metadata(): ENTRY pb_restore(): ENTRY pb_postpare(): ENTRY pb_cancel(): ENTRY pb_status(): ENTRY pb_error(): ENTRY refresh_reservedattrs(): ENTRY RPC Call Failed. Reason :Failed to connect to powersnap service.Reason free_impl(): ENTRY object id :%d object type :%d object subtype:%d mdk type:%d Metadata key :%s object_name: %s NULLTRUEFALSEGenerate indexes :%s index_name: %s object is NULL mover_attr: savetimeNSR saveset idTMPBR volume nameTMPBR start filemarkTMPBR end file mark/typeNSRmm operationmm operation idmm op message%sMark volumeMark save set start_mm_rap_op: The attrlist is not legal(attr name is too long or NULL)! Cannot update resdb. Unmark volumeUnmark save setSpecify save set flagsSpecify volume flagsPurge volumePurge save setDelete volumeDelete save setmm operation valueSpecify volume location%s/%sServer %s does not support remote index operationswrite failed to %s: %s rel offset %lu before data block of %lu bytes ending at offset %s lseek failed on file %s: %s read failed from %s: %s out of memory: %s internal error: expected %lu bytes, but got %lu got absolute seek offset of %s cannot handle files larger than 32 bits on this system, skipping position operation for `%s' `%s' not open, skipping seek operation Error reading from %s: %sout of memory verifying hole: %s rawasmreloff = %lu, output offset in empty asdf section. %lu bytes at relative offset %lu ending at offset %s absolute seek offset of %s skipped all %lu bytes, reloff now at %lu reusing buffer of size %u at %s output of file data failed for `%s' final output file data failed for `%s' final 0 byte at relative offset %lu ending at offset %s starting off %s, current offset %s, new reloff %lu [%s -r %s] error decoding ASDF section Warning: ASDF type 0x%lx version %lu not recognized stopping on warning bad save stream CRC match failure! Calculated value of %lu != %lu. ...missing hard links not found: %s [missing %d links]%s %s%s%s ./Name=`%s', name=`%s', fname=`%s' pathname %s not contained below %s bad directory %s: %s chdir(%s)%s%s prepend path %s ignored for %s cannot stat %s: %s %s%s%s is not contained below %s %s: Saving files modified since %s%s. Allocation failure, could not allocate devstats cannot allocate devstatswalk(%s, %s)%s Walking for %s Unable to allocate stat for %s creating hidden directory for `%s'%s%s %s: %s is holey%s cannot opendir "." (%s): %s Walking4 for %s cannot reopen `.' (%s) cannot chdir back to %s: %s readdir error: %s readdir overflow error, backup of directory cannot continue chdir(%s) [%s %s] path length of %ld too long, directory not saved: %s %s: path length of %ld too long, beyond the limit of %d, so, directory not saved:%s Savegroup`%s' change time %s%sdelaying backup of `%s' in `%s'%s %s appears to be a mounted file%s%s %s has different dev, but not a mount point%s%s %s appears to be automount point%s%s Device number changed from 0x%04x to 0x%04x for %s Warning inode number changed for %s may not be recoverable Inode number changed from %s to %s for %s Unable to allocate walk statattr Unable to allocate walk statattr: out of memory Unable to allocate walk olddot statattr Unable to allocate walk olddot statattr: out of memory %s -s %s%s [%s -s %s%s] path length of %ld too long, file not saved: %s Unable to allocate client attribute, file not saved: %s archivexdr_bytes failed for %s data read failed on %s: %s %s: path length of %ld too long, directory not saved: %s NSR_READ_SIZEnew read size of %u using min size %u instead of %s value of %u ignoring bad %s value of `%s' 0x%xusing read size of %u NSR_AVOID_ARCHIVEnoNSR_AVOID_ARCHIVE = %s %s%cnoireaddoing immediate saves without immediate reads %s: removing last direntry for %s%s %s: no direntry to remove for %s%s %s: removing direntry for %s%s %c<%%u>%cInsufficient memory to allocate contdir in savedir path length too long, directory not saved: %s %s: fid = <%lx, %ld> %s: no fid%s%s output of file id for %s failed! sr_catype = "UNIXATTR_LEN64" attributes for %s are %d bytes - too large! encode of file attributes for %s failed! getcwd failed .pure.qcurrent prototype asm specifications: << %s >> directory contents for %s: ./`%s' fileid=%5d bad printda() inheritance list %c : --- work list --- --- end work list --- /Memory error encountered on directive processing. Memory overwrite encountered on directive processing. forgetting previously inherited ASM specifications %s: `%s' directive takes no arguments, ignored%s %s: `%s' %s files already allowed .nsr%s: `%s' - allowing %s files to be used (again) //%s: `%s' - allowing %s files to be used %s: `%s' - now ignoring %s files (again) //%s: `%s' - now ignoring %s files %s: `%s' %s files already ignored xdr bytes failed -- bad save stream decompress jackpot %d > %d xdr bool failed -- bad save stream decompress bad header %x write failed to %s: %s filtering %u bytes for %s compress filterdata xdr failed for %s compress filter size limit exceeded %u > %u decompress filter bad header %x decompress filter failed ss cutoff %x end filtering for %s decompress expected %lu bytes, got %d Warning: The HP-UX ACL for `%s' cannot be recovered Warning: The HP-UX ACLV for `%s' cannot be recovered Warning: The PTX ACL for `%s' cannot be recovered Warning: The AIX ACL for `%s' cannot be recovered Warning: The Digital OSF/1 ACL for `%s' cannot be recovered aclfaclFound function %s at address 0x%lx Unexpected return value from ACL function call `%s': %d no extended ACL entry for `%s' Unable to read ACL information for `%s': %s ./Missing ACL functions. Unable to set ACL information for `%s': %s Warning: The Solaris ACL for `%s' cannot be recovered %s: skipping backup of unknown file type 0%o for %s Resetting 64-bit hard link size. internal error, no link info for %s ua_extattr.type = ET_SIZE64. ua_extattr.ea_size64 = %s %s: No such file or directory. %s: %s is a symlink to %s internal error, no symlink info for %s get extent64 attributes: retval = %d, fd = %d, extent = %lld, reserve = %lld, flags = %lld get extent32 attributes: retval = %d, fd = %d, extent = %lld, reserve = %lld, flags = %lld Warning: Failed to set extent for file %s, Unknown extent type %d. Warning: Failed to set extent for file %s, with errno = %d. set extent32 attributes: retval = %d, fd = %d, extent = %lld, reserve = %lld, flags = %lld set extent64 attributes: retval = %d, fd = %d, extent = %lld, reserve = %lld, flags = %lld ignoring bad %s -S arg `%s' %s -r: %u bytes at offset %lu lseek to %lu failed on %s: %s write failed to %s: %s lseek and write to %lu failed on %s: %s %s -r: writing zero at %lu [last offset %lu] xdr bytes failed - bad save stream xdr bool failed - bad save stream %s: recovering old style holey file `%s'%s general save/restore pointer not set file system object pointer not set no dxuldm priviledge for: %s cannot determine dxuldm mount for: %s. unknown dxuldm return code for: %s archiveretrieveno utdm access for %s allowed for file object: %s turned on dxuldm for: %s dxuldm initprocstate failed. %s, %d cannot save/recover non-dxuldm managed fs on utdm: %s dxuldm error for: %s. %s, %d DMAP_ROOT_PATH environment not set. cannot determine utdm status for: %s, error: %s, %d File not found: %s status pointer not set freed dxuldm proc context dxuldm proc context not initialized no dxuldm save information for: %s, error: %s, %d mount point crossed to non-utdm fs Found special file %s %s dxuldm_read_invis compare amount of data [migrated]%s dxuldm stub attribute data follows: %*s%s saved stub attr data for: %s, attr len: %lu, stub len: %ld %s err in output section stub data %s err in output section stub attribute %s no memory for dxuldm stub, size: %ld No stub No attributes, No stub Testing for hsm save there is no file stat information for: %s %s err output section for dxuldm attributes %s dxuldm file attribute data follows: %*s%s saved file attr data for: %s, attr length: %lu attribute pointer not set %s general save/restore pointer not set %s recovered stub and attribute data for %s %s dxuldm_write_invis wrong amount of data %s dxuldm_setrecoverstate for %s, (%s), %d %s dxuldm_initrecoverstate for %s, (%s), %d %s dxuldm_getrecoverinfo for %s, returned error (%s), %d %s retrieving stub: %s, file len: %s, stub len: %lu %s could not ftruncate file %s, bytes: %s. %s %s the file descriptor is invalid %s attribute length is invalid %s file length is invalid %s received stub data with no attributes %s trying to restore dxuldm stub for: %s %s attribute info is null for: %s %s nsr attribute info is null for: %s %s file name is null %s head pointer is null %s file handle pointer is null %s attribute length is greater than buffer %s retrieving stub attr data for: %s, attr length: %lu %s trying to restore dxuldm stub attributes for: %s %s recovered file attribute data for: %s %s retrieving file attr data for: %s, attr length: %lu %s trying to restore dxuldm file attributes for: %s file handle pointer is null ./%s dxuldm_recoverfile for %s, returned error (%d) %s Absolute path: %s %s could not get current directory. %s %s%smailasm restat'ing `%s' after getting lock%s%s Warning: The Digital OSF/1 meta data for `%s' cannot be recovered Warning: The DG/UX meta data for `%s' cannot be recovered Warning: The HP MPE/iX meta data for `%s' cannot be recovered %s: skipping %s%s type = %lu, mode = 0%lo, size = %s %s: %s%s invalid save stream no ASM id found for %s %s -r %s%s Skipping %s, %s does not support Verify. Cannot recover `%s' -- must be owner Permission denied for recover of `%s'%s%s%s %s: mapping `%s' to `%s' %s: mapping hardlink target `%s' to `%s' out of memory for mapping %s Can't verify pre-NetWorker 4.1 save stream for %s %s has been changed since save. %s has been modified since save. DATA MISMATCH FOR %s. Unable to stat file %s: %sCan't allocate memory for stat in default_verify xdr asdf hdr failed xdr bool failed xdr bytes failed xdr getbytes %u failed xdr checksum failed overwriting %s cannot overwrite directory with a file skipping recover of %s renaming %s to %s %s: file exists, renaming to %s %s: file exists, overwriting %s: file exists, skipping xdr bool failed -- bad save stream xdr bytes failed -- bad save stream write failed to %s: %s can't recover compressed windows files to this platform, skipping %s can't recover encrypted windows file to this platform, skipping %s directory path does not end in `%c': %s cannot create %s: %s bad block device mode o%lo for %s block mknod failed on %s: %s creating block device %ld, %ld for %s symlink failed %s: %s bad socket mode o%lo for %s path name too large for UNIX socket: %s bind failed %s: %s cannot create UNIX socket for %s: %s creating UNIX socket for %s%s%s unknown file type %ld, skipping %s bad FIFO device mode o%lo for %s creating FIFO for %s%s%s FIFO mknod failed on %s: %s bad character device mode o%lo for %s mknod failed on %s: %s creating character device %ld, %ld for %s cannot open %s: %s shrunk`%s' %s by %s bytes during save grew`%s' expected %s bytes. fini unknown file type %ld, skipping %s%s `%s' final f->offset = %s. Unable to read checksum from save stream ./createdirs: %s mode %o%s createdirs: %s exists, recheck%s%s cannot mkdir %s: %s out of memory for file %s%s, can't rename path too long, skipping %s%s name too long, skipping %s%s pathconf(%s, _PC_NAME_MAX) failed, using %u%s decoding NT data, sid type:%d length:%s cannot write to %s: %s extended attribute data for %s is not valid on this platform, skipping alternate data for %s is not valid on this platform, skipping object id data for %s is not valid on this platform, skipping reparse point data for %s is not valid on this platform, skipping sparse block data for %s is not valid on this platform, skipping Can't recover password protected data initda read ASMINHERIT for `%s' in `%s' error, `%s' is not within `%s'! initda da for %s cannot chdir to %s, %s: %s initda chdir to %s (%s) initda Name back to %s initda returning dirasm for `%s' in `%s' cannot chdir to starting directory %s: %s ignoring ASM directive file %s r%s: %s parsed%s Warning - could not parse %s%s cannot open %s: %s found protofile spec for %s: .illegal pattern %s matched external `%s' on `%s' for `%s' matched internal `%s' on `%s' for `%s' malloc failed no memory for copying asmspec in %s! walk_dirs bad ep cannot lock %s: %s unable to get mandatory lock on %s: %s (skipping) cannot open %s: %s save failed on %s ./reset `%s' to atime=%s, mtime=%s grewWarning - `%s' size %s during save Expected %s bytes for `%s', got %s bytes shrunkWarning - `%s' changed during save `%s' final f->offset = %s. insufficient memory: save failed on %s %s: %s change time not new enough: %ssuppressing selection of special file %s allowing selection of possible new special file %s %s%cnodevasmfile name too long%s: %s%s %s: %s file_get_stsize(), size = %s %s: no file data saved for %s (%s) swapasm_count: uasize64 = %s, stsize64 = %s write failed to %s: %s %s: filling in %s bytes for %s %s: creating %s zero bytes for %s %s: skipping filling of %s%s Backing up swapasm file > 2 gig, `%s'. create_thread_key_asm: unable to create thread-local storage key.xdr bytes failed -- bad save stream xdr bool failed -- bad save stream write failed to %s: %s %s: xorasm filterdata xdr failed for %ss %s: filtering %d bytes for %s %s: end filtering for %s getgroups%lu %s about to link %s to dir %s link to %s failed %s: %s could not stat %s link target %s: %s missing link name for %s!!! %s: %s is a link to %s Insufficient memory to create link %s!!! hl_save %s, nlink %ld, mode 0%o created link info %s for %s, nlink = %ld malloc failed, lost link information for %s freeing link info %s for %s%s          illegal tokenparse errorparser stack overflow%s line %d: %s ignored bad ASM argument '%s' in file %s idlist ile == NULL bad file name %s in %s, ignored malloc failed, cannot remember ASM info for %s ignoring ASM specification for `%s' in %s ignoring illegal external ASM name `%s' in %s ignoring file list for `%s' in %s ignoring `+' inheritance for `%s' in %s handling `%s' for pwd protospec for `%s'%s %s: got prototype for %s%s malloc for proto specification %s failed %s: duplicate directory spec for %s%s bad addap() inherit value of `%c' : %s__trace__id(%s) (%s) non printable char on line %d of %s bad quoted dir, line %d of %s bad dir spec, line %d of %s << %s >> %s bad quoted string, line %d of %s + %s-NSR_MASTrstdin directives/dev/nullcannot open nsr directive prototype file %s: %s could not parse %s ignoring directory specification for `%s' in `%s' - not contained within directory `%s' rawasm expected EOF at offset %s before %s bytes read rawasm queryfunc %s%s%s Map file name from %s to %s. rawasm cannot allocate %lu byte buffer: %s unexpected save stream EOF for %s %s bigger than expected size of %s bytes unable to decode more -- bad save stream xdr_bytes failed -- bad save stream write failed to %s: %s rawasm recover on %s [Length=%s]%s Unable to open `%s' for write: %s `%s' doesn't already exist, skipping recover rawasm new no length value for %s%s%s rawasm unknown -L length string `%s' for %s rawasm new length value of %s for %s%s rawasm length value of %s for %s%s rawasm no length specified for %s%s%s bad length `%s' %s: generating %s for %s %s: saved %s for %s bigasm save failed for %s %s: verified %s for %s bad save stream for %s expected data value %lu, got %luignoring bad %s -S arg `%s' external ASM `%s' not found or not executable xdr_flush failed before exec external ASM `%s' exited with code %d The following files in %s were not successfully saved: %s%s was not successfully saved cannot invoke external ASM `%s' %s died with signal %d %s: %s returns status of %d wait for %s: %s cannot spawn external ASM `%s' in %s: %s cannot setup external ASM `%s' cannot set up %s, pipe failed: %s unknown error running %s on file %s error running %s, cannot recover file %s error transferring file %s to %s[%s: -%c %s] -c-u-n-v./%s-r-i%c.R-p%d-t%u-z%s-s-b-C-e-p-i-x-t%lumalloc failed for string space to exec ASM %s %s: bad save stream from external `%s' %s: got %s, doing ASDF wrapping %s error encoding file %s: got %s, adding ASM for %s no memory%s: cannot decode/encode MBS item from %sr%s records (0x%08lx%08lx) %s header bytes (0x%08lx%08lx) %s data bytes (0x%08lx%08lx) %s: can't parse results from %s %s: adding %s to header count for `%s' ASM info %s: adding %s to header count to adjust for default ASM for `%s' Input from ext asm: recs = %s, hbytes = %s, dbytes = %s %s: fdopen for read from %s failed shutdown error on close for asm %s: %s asm %s cannot be invoked or died unexpectedly (unknown)cannot spawn external ASM `%s' for %s: %sxdrfd_create failed: %s unknown errorcannot set up %s, failed pipe setup: %s malloc failed, cannot set up %s error running %s, skipping recover of %s %s: skipping proto dir %s%s (pid %d): %s--- couldn't malloc %d bytes for ASMINHERIT : %s: bad ASM spec: %s%s%s: getasminherit dap of:%s%s %s: no memory for getasminherit%s%s %s (pid %d): getenv ASMINHERIT=%s--- %s: no %s enviroment variable set up%s %s: ASMINHERIT value too long%s%s %s: bad setasminherit() inheritance list%s%s YyNnRrunknown response `%s' %s%s EOF on fprintf & fflush NULL on Cfp fgets %s file exists, overwrite (n, y, N, Y) or rename (r, R) [%c]? cannot open %s /dev/ttyI18N of Interactflag unknown flag %c NSR_ORACLEASM_OFFNSR_STARTSIZECan not recover: bad oracle rawasm parameters - %s %s: Could not zero header.%s: Could not write out header.%s: Could not reset position to end of file.oracle_asdf_recover%s: Could not reset position to start of file.%s: Could not allocate buffer.%s: Could not position past OS reserved size.%s: ASDF type other than DATA used.%s: Could not unwrap ASDF section.%s: End of ASDF sections before Oracle header read. %s: error decoding ASDF section %s: Bad Oracle parameters. %s %cB%s Binternal incompatibility format error failed immediate send of %u bytes NSR_CHUNK_SIZEwrite chunk size %u continued save failed: %s unknown type (0x%lx) for file `%s' unknown type for file `%s' unknown version for UNIX file `%s' (possible newer version) unexpected continuation file `%s' cannot decode NetWare file `%s' cannot decode DOS file `%s' unknown version for DOS file `%s' (possible newer version) obsoleted type for file `%s' cannot decode DEC file `%s' cannot decode Unix file '%s' ndmpYestypenameNSR clientrd=device_path(), devpath: %s :device_full(), devfull: %s. device_host(), devfull: %s NSR devicemondaemon_check count %d checking file %s. nsrstage%s%c%slocked file %s; active storage node detectedremove temp file: %s. found lock file: %s. mondaemon_check, open error removing lock file %s locked file %s stopping process %d sleeping %d seconds mondlck.attr_pack al name: %s. attr_pack al val: %s. : ""; attr_pack str_outp: %s. nsr_attr_unpack, invalid entryattr_upack str_in: %s. attr_upack al_name: %s. attr_upack val_start: %s. NO_CLU_QUERYReduced cluster query. nsr_getserverhost(): returning clus_get_hostname() value TRUEget_client_vl from resdb_query: %s get_client_vl %s: %s jukebox_device_host(), client:'%s', server:'%s', jukebox:'%s' NSR jukeboxdevicesread hostnamejukebox_device_host(), error query jukebox: '%s' jukebox_device_host(), no jukebox named: '%s' storage nodesjukebox_device_host(), client storage node: '%s' nsrserverhostjukebox_device_host(), device node: '%s' jukebox_device_host(), no devices. NDMP jukeboxdevs_on_multi_hosts returning %d NDMP hostnameNDMP jukebox host name is NULL. clientname() passed, for %s. NetWorkerCan't start nsrd because %s (/nsr) is local, and NetWorker is configured as a cluster server. Use cluster manager to check NetWorker service status. localhostaliasesNSR poolpool_restricted_devs(), error query pool: '%s' pool_restricted_devs(),devices restricted to pool '%s' pool_restricted_devs(): volume not found %s %s: malloc failed%s%s namelocalhosttypeNSR clientaliasesclient OS typeindex path23:59:59NSR policybrowse policygroupretention policysave setAllintervalnumber of periodsperiod%s %s agoindex:%s%s%c%sNSR_INDEX_PATH_MAP<%d>index:%s%s:%s%s%s:%sindex:allbackupmigratedarchivensrccmailinformixmsexchmsmailmssqlnotessapmssqlsaporaclesybasedb2oracleindex_pconn got prog %lu instead of %lu index_pconn got unexpected vers %lu auth index preferred versionnsrindexdAuth server unavailable. sleeping... Index busy: `%s', snoozing... idxclntIndex busy. sleeping... no attribute found to setNSR_FILEIX_HINTinvalid hintNSRFX_HINT_1NSRFX_HINT_3NSRFX_HINT_2Use mmrecov to recover the server's indexcan't connect to indexd for purge (%s) index %s doesn't exist, skipping purge can't purge saveset from index %s (%s) can't commit purge to index %s (%s) skipping attempt to use immediate recovers %s%cnoimmediatefailed to map `%s' for ichunk file: %s NO_REFERENCE_IMMEDIATE_INLINEtypeNSR devicevolume namenameNSR pooldevicesenabledstatusThere is no pool named `%s'.NoCannot use disabled pool '%s'.get_device_enabled: failed rap request Yes service modedisabledread onlymedia typeNSR jukeboxauto media verifyRecycle to other poolsRecycle from other poolscouldn't find information for '%s' resource type'%s' is an invalid '%s'couldn't find information for '%s' attribute of '%s' resource typeNSR groupThere is no group named `%s'.Cannot use disabled group._AF_readonlyadv_fileloaded volumesvolume idNSR operationjukebox devicevolume operation0hardware id.ROfileVerify labelyesvolume labelNSR Storage Nodetype of storage nodendmpICHUNK ICHUNK NFILES %lu mm_ichunk failed: %s nsr_ichunk() doff %lu, ic_off %u ic_len %u, buf %s, cp %s nsr_ichunk not set for immediate saves! mm_ichunk_setup failed: %s failed to map `%s' for ichunk file: %s changing file mark interval from %lu to %u skipping attempt to use immediate saves %s%cnoimmediatewaiting on nsrmmd to get lock... lost connection to server [DONE] failed to reestablish immediate save context bogus lastidx value of %u is larger than expected max of %u, resetting waiting on nsrmmd buffers... shared buffers inactive, rebinding... alloc_irec() %u bytes at %s ichunk[%u] recidx %u off %u, len %u xdr flush for immediate buffer failed %s%climitreadget_immediate_buf() %u bytes at %s doff %lu failed immediate inline of %u bytes set_immediate_buf(): cp %s, bp %s, len %u, doff %lu change starting offset of ichunk[%u] recidx %u from %u to %u cut off ichunk[%u] recidx %u off %u, len %u cp %s, lp %s, pos %u, doff %u, off %u couldn't inline gap of %u bytes got a gap of %u bytes to handle set_immediate_buf(): bad sizes cp %s, bp %s, len %u immediate_mark flush, %u bytes left, %u ichunks xdr flush for immediate mark failed ichunk[%u] recidx %u starting off %u ichunk[%u] recidx %u off %u, len %u NFILES %lu ichunk[%u] recidx %u off %u, len %u failed to reserve %u bytes for immediate mark not doing immediate saves for marks! NSR_ISNOOZE_MSNSR_MAX_MSWAITsnoozing starts at %u ms per try going %lu milliseconds before blocking notice: get_ss %s successful after %d retries ?failed query for save set %s, (%s)ssid %s not in media dbfailed code assertionfetchss_ids failed ssid %s len %u notice: get_ss_range successful after %d retries failed range query, (%s)fetchss_all: missing host namenotice: get_ss_byname %s successful after %d retries failed query for saveset name %s, (%s)saveset name %s not in media dbnotice: get_ss_bytime (savetime: %s) successful after %d retries failed query for savetime %s, (%s)savetime %s not in media dbnotice: get_volume %s successful after %d triesfailed query for volume %s, %s (%d, %d)volume %s not in media dbvolume name must be specifiednotice: update_vol_op %s %s successful after %d retries Retrying update for volume %sInvalid volume update opcode:%dMedianotice: volume update for volid:%s successful after %d secs Volume information obtained from Media DB, was NULLLost connection to Media DatabaseRPC Failurecover no maskYes%ldauth mmdb preferred versionnsrmmdbdlgto_mmdb_auth auth failed: %s connect to mmdb prog %lu vers %lu on `%s' failed: %s %s This version of media database doesn't support this query. *coverset*snapset*coveridMalloc failed.lgto_mmdb_auth failed: %s undefmm_pconn got prog %lu instead of %lu mmd #%d ping got error %d, waiting... mmd #%d ping gets `%s' error unknown family type %d for host `%s' `%s' is not a known host name Unable to contact nsrmmd %dUnable to contact nsrmmd, no handleNo mm_handle for nsrmmd %dmm_null: sleeping for 1 second mm_clntmm_sstart RPC timeout... internal retrieve setup errorusing immediate recover mm_crstart RPC timeout... mm_crstart_a RPC timeout... NDMP CloneMM_clntmm_deactivate: mm_init FAILED for device %s mm_deactivate: clnt_call returned error: errnum = %d, errstr = %s immediate save (vers number 0x%x) set up failed skipping attempt to use immediate clones %s%cnoimmediatemm_direct_file_setup filed - no direct file no dirct filemm_direct_file_retrieve filed - no direct file mm_init: sleeping for %d second RPC create failed to nsrmmdmm_init: RPC create failed nsrmmdAuthentication failed or no valid authentication methods supported by both client and serverfetching cont dir `%s' for <`%s', ino #%s> cannot find continuation directory for `%s' continuation record for `%s' incorrect nsrapplogslogsdaemon.lognetworkr.logc:\networkr.lograp.logresnsrdbnsr.resnsrjb.resnsrla.restmpsecsgdebugcoresrapmmmmvolume6mmvolXXXXXXnsrim.prvindexjbconfigguiConnection already initiatednsrdAuthentication failed or no valid authentication methods supported by both client and serverRPC cannot make a procedure call: Create failedsaverecoverauth indexauth modeauth server%ldauth index preferred versionnsrindexdsave index auth failed: %s connect to index prog %lu vers %lu on `%s' failed: %s index start failed: %s Can't connect to index service on %s Can't open session for client %s to index service on %s No current connectionnsrclntapproved time %lu is not beyond current time %lu snoozing %lu seconds to sync up with approved save time... outrageous time difference of %lu between now %lu, suggested time %lu, and approved time %lu? no direct browsing to `%s' direct save returns: %s `%s' doesn't support direct saves: %s using indirect saves to `%s' mm save failuregot back %u instead of %u dispositions! got back nothing usable from versions on %s unexpected NSR_VOLUMES and NSR_VOLUMES32 RPC error %d on probe using host name of `%s' for mm service %luauth idauth versionnsrmmddirect recover mmd auth failed: %s connecting to mm prog %lu vers %lu on `%s' connect to mm prog %lu vers %lu on `%s' failed: %s NoYesstore index entriessetting `%s' value to `%s' SS cutoff sizeimmedate modeserver enabled for immediate mode remote userpasswordapplication informationsave mmd auth failed: %s mmsave setup failed: %s immediatedirectssid %s using %s save to `%s' got `%s' of %s from `%s' got `%s' value of `%s' off %s len %s file #%s %s Cannot contact nsrexecd service on %s, %s localhostUnable to contact system to determine port ranges or authentication methods: %s System does not support one of the following: configured network ports or configured authentication methods. nsrexecAuthentication failed or no valid authentication methods supported by both client and serverWaiting for nsrexecd to start. Service not available. service portsconnection portsadministratortypeNSR system port rangesSystem does not support restricted port ranges.NSRENV_RPCPORT_SERVICENSRENV_RPCPORT_CONNECTION%[^-]-%sInvalid range of ports configured on system.NSR_AUTH_METHODSauth methodsNSRLA,nsrports_init_from_env('%s', '%s') %s: unable to locate server. You should run '%s -s ' typeNSR clientnameRemote access all clientsremote accessUsing %s as server hostname%luONC program numberONC version numberNSRLAserverstcpcannot discover current directory contact namecompanystreet addressemail addresscity/townphonestate/provinceserver OS typezip/postal codefaxcountrypurchase dateproduct serial numberclient OS typeNetWorker versionCPUsenabler in useYesNoinitialize unloadeject initializeLoadUnloadLabelInventoryVerifyAddRemoveRelease DeviceSet cleaning cartridge uses left7gADIC-1200c/ADIC-1200dADIC-1200cADIC-VLSARC-DiamondBackDisabledEnabledscheduledrunningcompletedfailedAdd DeviceRemove Device1AixOSAviionOSClipperOSDecAxpOSDOSHpOSHpMpeOSLinuxMacOSNetWareOSOS/2ScoSco v4SequentOSSgiOSSinixOSSolaris on IntelSolarisSolaris PPCSunOSUnixWareWindows 3.1xWindows 95Windows NT Server on IntelWindows NT Workstation on IntelWindows XP Server on Intel ItaniumWindows XP Workstation on Intel ItaniumWindows NT Server on AlphaWindows NT Workstation on AlphaUX/4800Windows NT Workstation for AlphaWindows NT Server for AlphaWindows 2000 Workstation for ItaniumWindows 2000 Server for Intel ItaniumWindows NT Workstation for IntelWindows NT Server for IntelWindows 3.1Solaris x86SINIXIRIX SystemDYNIXSCO Unix System V/386SCONetWareMacintosh OSHP MPEHP-UXDigital UnixClipper OSDG/UXAIXsucceededabandonedwas never startedlast startstart timeCross platform recoveryNSRadministratorprivilegesnsrdnsrexechostnameONC program numberONC version number%luAuthentication failed or no valid authentication methods supported by both client and serverudpmm failed mm mark failed off %s len %s file #%s %s encode failed doing cut off for %s at size %s sscont returning failure %s: total size is %s, %s files, continuing <%u>%s:%s continued mm_sstart retrying: %s %s:%s continued save start failed: %s %s: continuing with ssid %s and save time %s %s: save set size is %s, %s file(s) %s:%s size %s, %lu file(s), took %3lu min %3lu sec unknown magic number 0x%lx cannot encode numbers xdr_sfhead encode failed Encoding SF_MAGIC3 saverec. Encoding SF_MAGIC2 saverec. Encoding SF_MAGIC1 saverec. Encoding "continued" saverec, forcing SF_MAGIC2 cannot decode more cannot decode numbers cannot decode appid xdr_sfhead decode failed sr_filename = %s cannot decode sr_id cannot decode sr_size cannot decode sr_savetime Decoding SF_MAGIC3 saverec. Decoding SF_MAGIC2 saverec. Decoding SF_MAGIC1 saverec. savefile_fini failed Unknown type (0x%lx) for object %s create_thread_key_nsr: unable to create thread-local storage key.create_thread_key_cc: unable to create thread-local storage key.create_thread_key_mif: unable to create thread-local storage key.NSR devicenametypevolume labelmedia familymedia typeno device named %svolume operationmessagevolume namevolume messageMountwrite enabledvolume typevolume current capacity%s: %s %svolume idlong volume idvolume error numbervolume expirationskipping attempt to use direct file recover on multiple savesets. df_read_direct cannot read %s, errno=%d df_read_direct cannot init %s, errno=%d df_read_direct cannot open file %s, errno=%d skipping attempt to use direct file recovers df_retrieve failed: %s df_retrieve cannot read %s, errno=%d df_retrieve using file %s. df_retrieve cannot open %s, errno=%d %s%cnodirectfileget_dfr_buffer - bad lseek. get_dfr_buffer returns NULL - end of data. get_dfr_buffer returns NULL - readv failed - i=%d, len=%d, usrlen=%d, iovcnt=%d, errno=%d! get_dfr_buffer returns NULL - (len < usrlen)! get_dfr_buffer returns NULL - no chnk. %s.%sskipping attempt to use direct file saves mm_direct_file_setup failed: %s mm_direct_file_setup cannot open %s, errno=%d %s%callowdirectfilesaves%s%cnodirectfileauth modeunknown ctxmode mode %d saveset consolidationauth indexauth ssnameauth ssname longauth levelstore index entriesauth serverclient id%sauth browse 64-bitYesNoauth esizeauth expiryauth recycle 64-bitauth expiry 64-bit%luauth sstime 64-bitauth sstimeclonesavebrowseno mode foundGot Short SS Name: %s Got Long SS Name: %s recoverunknown ctxmode mode `%s' auth index name spacegot %s when converting %lu to a string! name space conversion failed. Trying numeric conversion. name space '%s' converted to value %lu. returning name space value %lu. could not convert index name space value `%s' could not convert non-numeric name space value '%s' index name space value is %lu. nsrauthkerberosremote accessnsr_authenticate failed... enforce privileged portsauthentication port %d is not privilegedprivilegesRemote access all clients0.0.0.0invalid host name %sinvalid auth method string: missing comma between host address and auth methodsinvalid/unsupported auth method `%s'/invalid auth method `%s'/%s%s%s,%s%sNSRtypeclient auth methodserror parsing entry: %s invalid host name %serror parsing entry: %s %s.administratorNo privilege to view administrator listUser does not have %s privilege./r/etc/mnttabPath %s is within %s:%s (remote path %s) Path %s is within %s:%s Unable to open mount table `%s' full123456789incrconsolidateskipmigrationonsolidateullncrigrationkiptypeAttribute '%s' has a name that is too longhostnameONC program numberONC version numberONC transportloginpassworddomainAuthentication failed or no valid authentication methods supported by both client and serverEncryption required by server, but client failed to turn on encryption%luBad input variable to functionNull queryaccessadministratorall typesarchRAP areatype attributesONC authentication typebitmapcommandtypes createddefault areadefault RAP expire timeRAP expire timefilefirst problemtype helpiconlast problemlocalemachine typemastermodtimenameOptionproductprotocolRAP create accessRAP read accessrefreshresource identifierroleserverstatisticsstatustest attributetypetype nametype registereduserversionwaitencryptAllNoneAll HostsDESNETWAREUNIXdateDowndynamicFalsefixedhelphiddenInfokeyMasterNonocreatenullokradioRead onlyrosingleSlavetemplateTrueUpYesTrueFalseA boolean value of 'true' or 'false'.choiceYesNoA boolean value of 'yes' or 'no'.hand_query: illegal argumenttypehand_attr: illegal argument for attribute %s, type %s%s is a read-only attributeNo help information is available for this attribute.stringI18N: name = %s not Unicode: "%s" %s is longer than %ld characterschoicehand_choice: illegal initialization for attribute %s, try '%s' invalid choice for '%s'%s%s%lunumber%10lu%20s%s is too large%s is not a positive numberillegal range for attribute %s%s is not a number%s out of range (%d to %d)statisticsA list of names and values in the form: name=value. The name 'elapsed' gives the number of seconds since statistics counting started. A value can have an optional range represented by '/number' following the value.hand_statistics: no arg!hand_server_statistics: no arg!choiceresinfo_to_info: realloc failed %s%ldweight=%s%sclass=No help information is available for this attribute.datetrunctemplateradiofixedencryptkeynocreatenulloksinglehiddendynamicnumber%s %d %dresinfo_to_info: malloc failedtypetype nametype classestype referencesNot_Definedtype attributestype helpstring This is the type of this resource.rotypes createdhostnameONC name%*s: %s; resource identifierhostnamelocalelgto_auth: redirected to %s prog %lu vers %lu lgto_auth: fallback to prog %lu vers %lu retrying lgto_auth lgto_auth falling back lgto_auth retry lgto_auth for `%s' failed: %s lgto_auth for `%s' succeeded On decoding the credential: the authentication credential was corrupted, the checksums do not matchAuthentication failed or no valid authentication methods supported by both client and servernsrstatlgto_reauth auth call failed clntlgto_reauth_3 call failed (%d).lgto_reauth: redirected to %s prog %lu vers %lu localhostcannot contact server %s prog %lu vers %lu (%d)retrying lgto_reauth lgto_reauth falling back lgto_reauth retry lgto_reauth fail: %s lgto_reauth to `%s' succeeded lgto_reauth: fallback to prog %lu vers %lu lgto_parms: redirected to %s prog %lu vers %lu lgto_parms: fallback to prog %lu vers %lu retrying lgto_parms lgto_parms falling back lgto_parms fail: %s lgto_parms for `%s' succeeded build_lgtoauth_parms using override_uname: %s NULLcreate client handle for %s, %lu, %lu, %s failed, sleeping... Trueencryptauth methods nbrRPC Authentication: could not authenticate for %s, %lu, %lu, %s RPC Authentication: an old auth server issued the cred, it is not checksummed RPC Authentication: an old auth server issued the cred, it is not checksummed winwinlocalOn decoding the credential: the authentication credential was corrupted, the checksums do not matchauthentication type %u not adequateUnsupported authentication typepasswordloginnobodyResource parse error: %s %s%*s ^Unexpected end of input# Parse error on line %d: %s unknownmissing attribute namemissing separatorunterminated value listmissing separator between valuesname too largeresource identifier%s: %s at startupDisabledEnabledFalseNoNot usedNearLine PriorityRestart nowSCSI commandsSmartMedia PriorityStart nowServiceStart laterTrueYesnevernownoneremoveelapsedto serverfrom serverfrom masterunknownBad network mask: %s255.255.255.255%s = %s%s = %ld%*s: %s; resource identifierresdb_query: illegal argumentRAP Database query failed. errnum = %d and errstr = %s \.^$*[]typeillegal argumenttype%s%c%02d%csequence number %lu should be %lu or greater types createddirdb_etrans: not in transactionr+rResource database I/O is disabledcannot upgrade resfile0123456789abcdef~%s%c%setrans%s%c%02d%s%c%02d%c%sresdbg%s%c%s%c%s%c%s%c%sWARNING: NSR configuration database detected invalid resource %s Invalid resource saved at %s illegal argumentresdb_verify_no_trans: illegal argumentfiledb_etrans: not in transactiontypesequence number %lu should be %lu or greater %s%ctmp%c%s.lcknsrr+rResource database I/O is disabledCan not lock resource database file "%s" resource file %s already in use; check for another copy of this server already runningCan not open resource database file "%s" (%lu)%s resdb_net: illegal argumentA RAP database server must be specifiedresdb_timeout: illegal argumentresdb_callout: illegal argumentnetdb_delete: illegal argumentresnet_refresh: illegal argumentnetdb_close: illegal argumentnetdb_create: illegal argumentnetdb_update: illegal argumentnetdb_retrieve: illegal argumentnetdb_retlist: illegal argumentnetdb_getids: illegal argumentcreate_thread_key_rap: unable to create thread-local storage key.      -  #$%&'()*+, "- ./"34 '( &  !"#$%)+,./*   *[]$'%s' is not a trusted domain. NetWorker cannot validate users in this domain. Re-apply the change if that is okay.domain SIDuser SIDdomain PDCparse errorparser stack overflow#=&@/, usergroupdomaindomaintypehostdomainsidusersiddomainpdcisrootTRACELogAccessGrantLogAccessDenyLogUserUnknown directive '#%s' rootnisKerberosNTLMAdministratorswin'%s' is not a known host or trusted domain. NetWorker cannot validate the identity of these users. Re-apply the change if that is okay.*The domain %s used by user %s is not accepted because it is a only known host name and not a trusted domain namelocalhostHost name %s is not validwinlocalInconsistent Domain and User SID user %s on host %s was granted %s access by '%s' nobodyuser %s on host %s was granted %s access' user %s on host %s was denied %s access. clientcred = %s time = %lu exptime = %lu domaintype = %s domain = %s TRUEFALSEcanonclient = %s machname = %s groups_len = %u application = %lu user = %s groups = %s Cannot parse '%s'type helptype referencestypetype attributestype nametype classesNo resource type information is available.Not_Defined:; reshand_call: illegal argumentResource type: %s; is read-only.UNKNOWNnamequeryhand_call: illegal argumentNo type in internal resource!nullWARNING: NSR configuration database found resource entry with too many resources Please check your configuration! WARNING: NSR configuration database found invalid resource type Please check your configuration! %s has too many valuesattribute %s must have a value%s must be %s%s...----------------- %s: %s@%s CREATED '%s' resource with attributes: MONITOR_RAP%s: %s@%s CHANGED '%s' resource, %s: %s: %s@%s DELETED '%s' resource with attributes: aHANDOP_CHECKRESHANDOP_CHECKATTRHANDOP_DELETERESHANDOP_UPDATERESHANDOP_CREATERESUnknown rap operationHANDOP_INITRESHANDOP_INITATTRHANDOP_UPDATEATTRHANDOP_RETREVATTRHANDOP_TYPEATTR%suser %s on machine %s is not on %s listunknown machine accessRAP read accessadministratortypes createdtype:%s cannot be %screateddeletedtypeunable to retrieve creator of type:%sunknown user%s@%s%s/%s@%sRPC Authentication: Client successfully authenticated using AUTH_LGTO authlgto_refresh to '%s' failed RPC Authentication: Client successfully authenticated using AUTH_UNIX NSR_TRANSPORTtcpCalling clntudp_create function Calling clnttcp_create function pipeshmsppudp%s: %s; errno = %s; why = (unknown authentication error - %d); low version = %lu, high version = %lu; s1 = %lu, s2 = %lu%sUnknown error codeRPC: %s - Authentication OKInvalid client credentialServer rejected credentialInvalid client verifierServer rejected verifierClient credential too weakInvalid server verifierFailed (unspecified error)NSR_BLOCKING_RPCCannot bind socket to connection port in configured port range on system %s. TRUEFALSEMUSTNSR_SOCK_BUF_UNSETThe environment variable NSR_SOCK_BUF_UNSET is set to '%s'. This overrides default behaviortcpping_svc: bad arguments. rpcinfotcpping_svc: program %lu version %lu is not available tcpping_svc: program %lu is not available tcpping_svc: get_inet_address function error. program %lu version %lu ready and waiting error calling program %lu version %lu rpcinfo: %s is unknown host pid %u frag size %lu, closing connection Cannot bind socket to connection port in configured port range on system %s. NSRENV_PMAPS{%lu,%lu,%lu,%lu}Cannot create socket for broadcast rpcBroadcast select problemCannot receive reply to broadcastCannot send broadcast packetCannot set socket option SO_BROADCASTbroadcast: ioctl (get interface flags)broadcast: ioctl (get interface configuration)cannot bind%s %scouldn't do tcp_createcannot create socketcouldn't do udp_createsvc_sendreply superusertcpAdding port range (%s): %d-%d socket bound to port %d socket bind failed, port %d, (errno %d) %s socket bind failed, port %d, %s , retrying...socket bound to arbitrary port socket bind to arbitrary port failed (errno %d) getsockname(%s) using port %d connectionservicereservedunknownHost name verification failed - unknown transport %d%s Warning, cannot resolve host '%s' to '%s', name server may be misconfigured. %s Host name verification failed - unknown host: %sName resolution failed for the host with IP address: %ssvc_req_client: %s svc_req_client(): skip_host_auth is set. svc_req_client(): returning host name: %s Error: Failed to register the RPC transport unsupported auth typesetting the NOFILE limit from %ld to %ld svctcp - cannot listensvctcp - cannot getsocknameCannot bind socket to service port in configured port range on system %s. svctcp - tcp socket creation problemtcp socket creation problem: %ssvc_tcp: svcfd_createerror from accept callinvalid connection from %s/%u to %s/%u.remote machine is %s/%u and local machine is %s/%u. client connection from %s/%u to %s/%uservice at %s/%u%d cannot accept any more connections - %s Aborting , %s NSR_TCP_READ_LONG_WAITThe environment variable NSR_TCP_READ_LONG_WAIT is set to '%s'. This overrides default behavior. NSR_NO_PINGpid %u frag size %lu, invalidating connection svcudp_createsvcudp_create - cannot getsocknameCannot bind socket to service port in configured port range on system %s. svcudp_create: socket creation problemcache_set: victim not found%s cache_set: could not allocate new rpc_buffercache_set: victim alloc failedcreate_thread_key_rpc: unable to create thread-local storage key.NSR_CHECKSUMS_DIRNSR_DEBUG_DIR%s%c%snowritevnoreadvnodelayeorblockingonlyWROTE: cnt %10lu READ: crc %10lu sum %10lu cnt %10lu READ: cnt %10lu nblock %3u WROTE: crc %10lu sum %10lu cnt %10lu%s%cno%sclntservcntonly%s,pid_%u,%s-%scannot use non regular stats file %s %s,pid_%u,fd%unon-IP sock, cannot generate name %u.%u.%u.%u:%ulocalhostport=%u%s:%unoabortconnnoremovefragmax%luxdrrec2_create: Invalid send buffer type xdrrec2_create: Invalid receive buffer type xdrrec_skiprecord unaligned input pointer xdrrec: skipping previous record cnt:%ld, mid:%d, bufd:%d xdrrec: skipped previous record, new record is not buffered Attempted to fill the input buffers without calling crypt_set_input_fragment when encryption was turned onThe information that is needed to encrypt data may be expired. Attempting to refresh it pid %u got record frag of %lu bytes NSR_DEBUG_DIR/nsr/debug%s/%sNSR_MOVES_DOUBLES%s=%cCould not add the fd to the fdtable because the fd was already registered in the fdtable Adding ssnchnl: session id = %x ssn (pointer) = %lx ops = %lx fd = %ld Removing ssnchnl: ssn = %lx fd = %ld Could not remove fd: %ld from fd table, fd not found fdtable: Attempted to remove fd from the table Warning: no fdtable handler provided, but running the handler was requested, no handler will be run Warning: fdtable handler provided, no run type was requested handler will not be run Warning fdtable run on timer requested, but no timer supplied, handler will not be run on timer An fd with data was found in the fd set, but not found in the fdtable (unknown) Channel exited with status: %s%d fdtable: Logic error: ssn_destroy did not remove the fd entry Cannot register service%sMust specify an SVCXPRT to create_rpcssn_xprt rpcssn: session id: %x was already associated with a ssnchnl_fdtable. re-associating with a different fdtable rpcssn: session id: %x, Warning: A RPC session_channel must always have an fdtable session id: %x, Can't call message handler because the message handler depends on a session channel (pointer): %lx that has already exited. Calling the default handler. session id: %x, Can't call the default message handler because the default message handler depends on a session channel that has already exited. Calling the ssncommon_default_usermsg_handler. session id: %x, Handlers can not be specified for protocol messages session id: %x, User defined message not understood. Message type: %d, request type: %d Routing message from session id: %x to session id: %x Routing exit status to session: %x Cannot find uid %d from password file, %s%ld:%ld:%ldcreate_msgssn_envstring: Did not get the right number of file descriptors from the environment variablemsgssn: session id: %x could not receive exit code The peer did not understand the requestmsgssn: session id: %x Received keep alive message msgssn: session id: %x Can't receive because the session channel is closed. msgssn: session id: %x Can't send because the session channel is closed. msgssn: session id: %x the message id must be valid when routing a message msgssn: session id: %x got error on write: shutting down the channel msgssn: session id: %x was already associated with a ssnchnl_fdtable. re-associating with a different fdtable %s=%s:%s%s=%sgemsgst/%s./%.*s%*s: %s\ %s %s %*s%s, *; /dev/null%s%c%shostidsr%s/fullcanon(name=%s) %s%c%s exit fullcanon(fullname=%s) Cannot get current directory! nsrnetworkr.cat#1Message catalog "%s" incompatible version. Message catalog "%s" found. Message catalog "%s" NOT found. .catnotLocale"%s" found. Lang Subdir is"%s". unknownCnNqQrRyY%s%s%sen_USen_US.UTF-8.eucJPzh_CN.EUC.iso88591.ISO8859-1%s.8859-1.PCKzh_CN.GB2312-80jajapanja_JPjapanesefrdechinesezh/dev/ttyrwabcdefghijklmnopqrcan't remove file '%s' %s%c%scan't remove directory '%s' ...SuccessSYSTEMRPCRAPWISSNetWorkerJukeboxFile indexMedia DBnotice%s %s: %s%s %s, %s%s warningerror (%u) (severity %u, number %u) (type %u, severity %u, number %u) (number %d)err_save: overwriting old tmperr <%s> Dropping error string %s %s->(%s)Malloc failed. %sRPC cannot encode argumentsCan't decode resultRPC send operation failed. A network connection could not be established with the host.RPC receive operation failed. A network connection could not be established with the host.Timed outIncompatible versions of RPCAuthentication errorProgram unavailableRPC program or version mismatchRPC server is unavailableServer can't decode argumentsRemote system errorUnknown hostPort mapper failureProgram not registeredFailed (unspecified error)Unknown protocolCall interruptedRemote address unknownTLI errorBroadcasting not supportedName to address translation failedRecv got uderr indicationAsync rpc in progressStale remote asynchronous handleInvalid handleCancelledOperation not supportedBad getids argumentsBad lg_wcreate argumentsBad delete argumentsBad update argumentsBad retrieve argumentsBad or missing hostnameBad or missing version numberBad or missing program numberBad or missing attribute nameNo such typeResource does not existPermission deniedCreate permission deniedUnknown areaUnknown mastersystem errorsequence number mismatchResource already existsResource database failureResource parse errorIllegal values selectionIllegal numeric valueToo many valuesRead-only attributeNo such attribute in this typeNo type attribute specifiedNo such hostNo such netgroupNo such attributeBad resource database pointerResource database busy/../lib/nsr//../../lib/nsr//../../bin//../../sbin//../bin//../sbin//../bin/nsr//../sbin/nsr//../../bin/nsr//../../sbin/nsr/Origin not set, using `%s' for execpath `%s%s' exceeds %u characters for execpath %s%c%s%s%s%s`%s' not accessable, using `%s' as execpath for `%s' using `%s' for execpath, /etc/vfstabr/etc/mnttabhsfsprocfdcachefslofsnfs2nfs3nfs3prefnfsbrfsmsdosdfsiso9660smbfsusbdevfsdevptsswapswapfstmptmpfsnucfsnucamfdfsxxnoneprocfspcignorenobackupsfullpath getcwd failed on %s fullpath failed to get the new cwd /fullpath(%s) cannot restore cwd to %s: %s %s%c%s path is too long cannot chdir to %s: %s getcwd failed on %s fullpath(%s): cannot determine current directory cannot stat %s fullpath could not lstat %s: %s fullpath could not readlink on %s: %s fullpath path name too long %s%s: %s fullpath follow_path returns `%s' fullpath too many symlink loops for %s: %s get_myaddress: flags ioctlget_myaddress: ioctl (get interface configuration)NSR_IFNUMget_myaddress: socket  !!!! ./01  !$ (*,%)+-532& '64"# *&  #*,-/01)9+D78) 0;</ !,1-2.3$%"=#&4'(BC569:>?@AE+         parse errorparser stack overflowjanuaryfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaymondaytuesdaytueswednesdaywednesthursdaythurthursfridaysaturdaya.mamp.mpmnstn.s.tasta.s.tadta.d.teste.s.tedte.d.tcstc.s.tcdtc.d.tmstm.s.tmdtm.d.tpstp.s.tpdtp.d.tysty.s.tydty.d.thsth.s.thdth.d.tgmtg.m.tbstb.s.teete.e.teeste.e.s.tmetm.e.tmestm.e.s.twetw.e.twestw.e.s.tjstj.s.taesta.e.s.taessta.e.s.s.tacsta.c.s.tacssta.c.s.s.tawsta.w.s.tyearquartermonthfortnightweekdayhourminuteminsecondssectomorrowyesterdaytodaynowlastpreviousthisnextfirstsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfthagoonetwothreefourfivesixseveneightnineteneleventwelveeveryabcdefghiklmnopqrstuvwxyzGMT23:59:59foreverlocalhostReverse DNS lookup failed for host %s, address %s %sIllegal/NULL hostname detected (%s) MAX_DNS_CACHE_SIZEMAX_CLIENTS_CACHE_SIZEReverse DNS lookup failed for address %s %.19s GMT%c%.2d%.2d %.4si18n_gmt_ctime: using C locale i18n_gmt_ctime: using %s locale %a %b %e %X%Y%cunexpected lockf problemlg_open(): Calling open64(). lg_open(): Calling open(). lg_creat: Calling creat64(). lg_creat(): Calling creat(). lg_lseek(): Calling lseek64(). lg_lseek(): Calling native lseek(). lg_statvfs(): Calling statvfs64(). lg_statvfs(): Calling native statvfs(). lg_fstatvfs(): Calling fstatvfs64(). lg_fstatvfs(): Calling native fstatvfs(). lg_ftrunc64(): Calling ftruncate64(). lg_ftrunc64(): Calling native ftruncate(). lg_stat(): Calling stat64(). lg_stat(): Calling native stat(). lg_lstat(): Calling lstat64(). lg_lstat(): Calling native lstat(). lg_fstat(): Calling fstat64(). lg_fstat(): Calling native fstat(). open64creat64stat64lstat64fstat64statvfs64fstatvfs64lseek64ftruncate64find_64bit_func(): %s This system has 64-bit file system calls.This system does NOT have 64-bit file system calls.Warning: 64-bit inode number uses high order 32-bits. 0123456789abcdefghijklmnopqrstuvwxyz0x%0*lx0xTRUEclustersvr.clu_pathl_hostmatch: parameter problems NO_CLU_QUERYClu_cluster_type = LC Clu_cluster_type = NATIVE clu_pathl_gethost: path is NULL clu_pathl_getmounts: host is NULL clu_pathl_addpath: pathname is NULL clu_pathl_finalize: getlocalhost() is NULL pathlist_add_a_clushost: parameter problems clu_pathl_getvolname: parameter problems pathlist_set_hostname: host is NULL clu_is_localvirthost(): unknown cluster type os_vers_major_num(): ENTRY ... os major version = %d uname.sysname = %s uname.version = %s version failure ... uname.machine = %s uname.nodename = %s uname.release = %s Searching for NetWorker bin 'pathownerignore' file. %s%spathownerignoreDetected ownership override file %s. pathlist_get_hostname: bad counting pathlist_get_hostname: host is NULL fullpath2() expanded %s to %s couldn't map rel path %s /partly mapped rel path to %s fullpath2() couldn't expand %s clu_init_lc(): ENTRY... clu_init_lc(): Can't build fspath_vhost_map... locally active virtual host name -> %s dump_map_lc(): ENTRY ... elemp-> fspath=%s vhostname=%s ipaddr=%s TRUEFALSELc_use_local_vhost_list = %s local_vhost_listp->local_vhost=%s MOUNTED filesystems expanded_mnt_dir=%s dump_map_lc(): EXIT ... do_network_id(): input buffer = %s gethostbyaddr doesn't know host %s Unknown format of host %s clu_is_localvirthost_lc(): search for host %s clu_is_localvirthost_lc(): NULL hostname clu_is_localvirthost_lc(): ENTRY... get_vhost_by_path_lc(): ENTRY... get_vhost_by_path_lc(): ->Found %s, returning %s ->Can't find %s, returning NULL ->searching for: %s ->input path: %s get_vhost_by_path_lc(): returning NULL validate_and_massage_fspath(): ENTRY ... %s is valid - ok %s is fs mount dir - ok removing any trailing slashes %s is neither raw device nor fs mount dir - rejecting %s is raw char device file - ok %s not stat()'able - rejecting mntent-> mnt_fsname = %s NULL mnt_dir = %s mnt_type = %s mnt_opts = %s mntent = NULL is_mounted_filesystem(): EXIT ... Problems with getmntent to verify filesystem... is_mounted_filesystem(): ENTRY ... fully_expand_path(): ENTRY ... null input arg fullpath2() expanded fspath %s to %s fullpath2() couldn't expand fspath %s /mapped rel fspath to %s clu_is_cluster_host_lc(): ENTRY ... clu_get_vhost_mntent_lc(): ENTRY ... returning %s as cluster mnt_dir clu_get_vhost_mntent_lc(): EXIT ... returning NULL Problems getting the list of mounted filesystems - returning NULL search_by_max_fspath_lc(): null input arg input fspath=%s Lc_fspath_vhost_elemp-> search_by_max_fspath_lc(): ENTRY ... get_lc_fspath_vhost_map(): ENTRY ... /usr/sbin/lcmapNSR_LCMAP_LINE_SIZE%srLc_cluname set to %s. localowned pathscluster status set to active ... Lc_nodename set to %s. Decoding line: %s clu_typeNSR_LC_TYPEclu_nameinterface versionnodenamehostname get_lc_fspath_vhost_map(): EXIT ... Error popen'ing buffer %s ... Error formatting command %s ... No access to file: %s ... Problems reading output of lcmap(.bat) file ... getlocalhost_lc(): returning value: %s getlocalhost_lc(): returning value: getlocalhost() clu_dflt_name_lc(): ENTRY ... returning %s clu_has_cfs_lc(): ENTRY ... clu_pathl_getmounts_lc(): ENTRY ... input host is not valid cluname host - returning null ... add_all_lcmap_as_mntpts(): ENTRY ... malloc error ... add_all_lcmap_as_mntpts() adding: %s not a valid path. /etc/mnttabsetmntent() succeeded ignoreinvalid fs - ignored ignored create_mntent_list(): EXIT ... setmntent() failure create_mntent_list(): ENTRY ... /opt/SUNWcluster/bin/bin/sbin/usr/sbin/usr/binr%s -f all_logical_hosts%s -f vfstab_file -h %sError popen'ing "%s" ... %s -f masteredCannot find the Sun Cluster haget utility. Use $HA_UTIL to point to the location of the High Availability utilities. HA_UTIL%s%chagetgetenv_ulong: improperly formatted string '%s' getenv_ulong(%s, %lu) returning %lu @(#) Product: NetWorker@(#) Release: LNMs_2004.Build.273@(#) Build number: 273@(#) Build date: Thu Apr 14 19:10:43 2005@(#) Build arch.: solaris7w@(#) Build info: DBG=0,OPT=-O3 -fno-strict-aliasingset_nonprivileged: saved uid %d euid %d, current uid %d euid %d set_nonprivileged: new uid %d euid %d set_privileged: saved uid %d euid %d, current uid %d euid %d set_privileged: new uid %d euid %d %s Copyright (c) 1991, 1993 The Regents of the University of California. All rights reserved. This code is derived from software contributed to Berkeley by James W. Williams of NASA Goddard Space Flight Center. Redistribution and use in source and binary forms, with or without modification, are permitted provided that the following conditions are met: 1. Redistributions of source code must retain the above copyright notice, this list of conditions and the following disclaimer. 2. Redistributions in binary form must reproduce the above copyright notice, this list of conditions and the following disclaimer in the documentation and/or other materials provided with the distribution. 3. All advertising materials mentioning features or use of this software must display the following acknowledgement: This product includes software developed by the University of California, Berkeley and its contributors. 4. Neither the name of the University nor the names of its contributors may be used to endorse or promote products derived from this software without specific prior written permission. THIS SOFTWARE IS PROVIDED BY THE REGENTS AND CONTRIBUTORS ``AS IS'' AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE REGENTS OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. NSR_MASTNSR_PRINT_UIDSgst%s%clgdbg.tmpNSR_CATCH_CHILD_STDOUT%s: %s %s%d.%dnullNSR_SHUTDOWN_STDIO0NSR_SHUTDOWN_STDIO=0(pid %u)PATHNSR_PRINT_ORIGINorigin for `%s' is `%s' unable to execute with hard links to binary %s .notice,notice:warning,%swarning:Diagnostic: %s %s: adfopen: filename is null ... dfopen: Unable to open file %s for writing. dfopen: Opened file %s for dprintf writing. dfclose: File stream close failed. NSR_STRICT_LEVEL%02x%s%cnosysvshmemskipping use of System V shmem mmap shmem create failed: %s unable to allocate shared memory: %s sysv shmem create failed: %s sysvmmapnot compiled to support shmem type `%s' for `%s' unable to handle shmem name `%s' %s %s%c%s%c%ufailed to initialize %s: %s tas_reset: null lock address failed to create %s: %s %s%c%s.nsrwskip: * .?* semid %ushmget failed to get %lu memory buffer: %s could not parse shmem name %s shmat on %s failed SHMEM_NOPOPULATE%8.8sno date%2d/%2.2d/%2.2d%17.17s-----no time-----%2d/%2.2d/%2.2d %2d:%2.2d:%2.2d%a %Xforever%x %X%m/%d/%y %H:%M:%S%Y_%m_%d.%H_%M_%S%xno time%XnobodyLANGLC_CTYPELC_NUMERICLC_TIMELC_COLLATELC_MONETARYLC_MESSAGESLC_ALLNSR_CATCH_CHILD_STDOUTDMAP_ROOT_PATHNSR_MAST=%s%s=%sdup2: %s /bin/sh-ccannot exec %s: %s %s started, pid %d %s waiting, pid %d %s terminated abnormally, pid %d, exit status %1d %s (pid %1d) terminated due to signal %1d %s process started, pid %d /dev/nullwaitchild error on reap, pid %d (%d) waitchild reaped, pid %d Error %d Windows NT Server on IntelWindows XP Server on Intel ItaniumWindows NT Server on AlphaAixOSAviionOSDecAxpOSHpOSHpMpeOSLinuxScoSco v4SequentOSSgiOSSinixOSSolaris on IntelSolarisSolaris PPCSunOSUnixWareUX/4800SPARCworkstation Sun-4/200serverSPARCserver 400SPARCserver 300Sun-4/110SPARCstation-10SPARCserver 690Sun-4/60Sun-4/40Sun-4/65Sun-4/20Sun-4/75Sun-4/25Sun-4/50Sun-4/70Sun-4/80Sun-4/10Sun-4/45Sun-4/5Sun-4/85Sun-4/32Windows NT Workstation on IntelWindows XP Workstation on Intel ItaniumWindows NT Workstation on Alpha0create_thread_key_liblocal: unable to create thread-local storage key."\ () "'\"\ '\ " ) current token = %s tokenize: realloc; numtokens = %d; token_size= %d Cannot realloc for tokens Cannot alloc for tokens %lu%02x%08x-%08x-%08x-%08x-%08x-%08x-%08x?ffffff\UNC\\\?\UNC\\\?\\\\??\UNC\pipe\PhysicalDriveTape.rootnobodyglsmixed%s%c%s%c%sCleaning up mixed codesets. Codesets unified. |vallist_add2(): invalid input %2d) %-21s %2d) %-24s %2d) %s /dev/nullDebugChanging Debug level of process (id %d) from %d to %d VflagPrintDevInfoChanging Vflag level of process (id %d) from %d to %d Changing PrintDevInfo of process (id %d) from %d to %d %s is an invalid value for %s NSR_DEBUGPROCS%d waiting to be debugged applogsbincoresdebugetcglsindexliblogsmmmodrapressectmpPURIFY_IS_RUNNINGPurify is running %s%c%s%c%s%c%s%s%c%s%c%score.nsr%s.%2.2d.%2.2d.%2.2d%s.%d%sskip: * %s.unknownDXULDMLIB/.DMATTRusiopathusiispurusiismig%s:%d:%s RegionDM:%d:%lld:%lld:%s uvdmrest1RegionDM%d%llurwt-wt%u%s/./etc/mnttabrutdm/etc/dxuldm.pathDMAP_ROOT_PATH=%sDMAP_ROOT_PATH%s/etc/DXULDM.confFS:%s/adm/recdirrec.%lu.%ulock.%s.%u%s/%s%sa%s %s/adm/bin/dxuldmrecover-p/dev/utdmapiopendm_get_config: hlen (%lu) > max (%d) dm_get_config_events: hlen (%lu) > max (%d) dm_get_config_events: nelem (%d) < max (%d) %s: heln (%lu) > max (%d) %s: rightp is a NULL pointer %s: hlen (%lu) > max (%d) HANDLE: ino = %lu igen = %lu fstype = %d hantype = %d hfsid.val[0] = 0x%.8x hfsid.val[1] = 0x%.8x %`0o0o0o0o0o 0o@0o`0o0o0o0o0o0o 0o@0ow`0oo0og0o_0oW0oO0oG 0o?@0o7`0o/0o'0o0o0o0o 0o@0o`0o0o0o0o0o0o 0o@0o`0o0o0o0o0o0o 0o@0ow`0oo0og0o_0oW0oO0oG 0o?@0o7`0o/0o'0o0o0o0o 0o@0o`0o0o0o0o0o 0o 0o @0o `0o 0o 0o 0o 0o 0o 0o @0ow `0oo 0og 0o_ 0oW 0oO 0oG 0o? @0o7 `0o/ 0o' 0o 0o 0o 0o 0o @0o `0o 0o 0o 0o 0o 0o 0o @0o `0o 0o 0o 0o 0o0o 0o@0ow`0oo0og0o_0oW0oO0oG 0o?@0o7`0o/0o'0o0o0o0o 0o@0o`0o0o0o0o0o0o 0o@0o`0o0o0o0o0o0o 0o@0ow`0oo0og0o_0oW0oO0oG 0o?@0o7`0o/0o'0o0o0o0o 0o@0o`0o0o0o0o0o0o 0o@0o`0o0o0o0o0o0o 0o@0ow`0oo0og0o_0oW0oO0oG 0o?@0o7`0o/0o'0o0o0o0o 0o@0o`0o0o0o0o0o0o 0o@0o`0o0o0o0o0o0o 0o@0ow`0oo0og0o_0oW0oO0oG 0o?@0o7`0o/0o'0o0o0o0o 0o@0o`0o0o0o0o0o0o 0o@0o`0o0o0o0o0o0o 0o@0ow`0oo0og0o_0oW0oO0oG 0o?@0o7`0o/0o'3OsӋӗZӣӮӮ i o;owoX8xHRH oo%A             , , , , h h h h             X X X X                               N'`<  `         < x   , h    X     L    \    l 0 /usr/sbincompressasmposixcrcasmxlateasmforgetmntasmallowignorepw1pw2atimeasmmtimeasmalwaysskipnullasmnullheadasmholey@_logasmmailasm.lock.nsrswapasm-----*asm : > : rawasmbigasmB@ASMINHERIT :*!*!* File Conflict *!*!* *?*?* Groom File *?*?* zuasm%s%cadv_ssids%c%s%s%cadv_ssids9Q</nsr/debug/nsr/checksums@(NSR_MOVES_DOUBLES<This product includes software developed by the University of California, Berkeley and its contributors? ;n C&vkkMGP&"/+Ka5 d1͆< 8OLpHEAR_[԰VRVuj6n+c gZy@}]p{zt^f͘#W`9'<݋Rd+[XF﷩`6h}/-03l ]2mp'ݰVqKI6Lδ "u=:(Fy>C͚}-4pw0Gm=K9V'#C.=* rOx ͻK} x|VqiuԍkoRlbf^FZ^[W}S`fM0cIZ-D @Ɨd 'NK`#%▒+/l6/A ]h@D+f{*uP6&;>k;qv2PUMƼ_}>1ֆոy4:Zi mY`ۀdO7z2~ɋs\wKO VKF68BG+\{Xf=U@QC]S%;!&),(^G6MB2P?v,;Zk&ˑ HVнMR#/VKm`lp+ =eh 'ޥdo#j͡`볽>~ɴ}:̣y{6`Ɵ}q[uF2 -tq0]YK.TPɶ@NEJOG +C{}!C`rFOv[h lGJa0e-$KZV^pm0=5^ [7Q3R>?:Ѐ$Ѝ V:-)Tũ&yh;+֭PlM/kv|`v#d'sĉ yྀ:gК՞}b> q 2+ߢ6hfmu{ڵ6]@Licensed under U.S. Patents 5,140,321 and 5,281,967 and foreign counterparts  $RCSfile: dxbackrec.c,v $ $Revision: 260.13 $ $Date: 2003/11/04 03:33:54 $$RCSfile: lib.c,v $ $Revision: 260.0 $ $Date: 2002/11/05 16:52:44 $dm_query_rightdm_release_rightdm_request_right73" #SRPQ '&!EHTd7d d7ddas: WorkShop Compilers 5.0 98/12/21 $Id: errutil.c,v 1.1.2.8 2005/04/12 14:02:21 kowens Exp $ Copyright (c) 2005, Legato Systems, Inc.$Id: sbtpc_meta.h,v 1.1.2.2 2004/07/13 22:16:05 kowens Exp $ Copyright (c) 2004, Legato Systems, Inc.GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: info.c,v 1.1.2.4 2005/01/27 22:20:18 kowens Exp $ Copyright (c) 2005, LEGATO Software, a division of EMC$Id: sbtpc_meta.h,v 1.1.2.2 2004/07/13 22:16:05 kowens Exp $ Copyright (c) 2004, Legato Systems, Inc.GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: nwora.c,v 1.1.2.11 2005/04/07 12:11:41 kowens Exp $ Copyright (c) 2005, Legato Systems, Inc.$Id: sbtpc_meta.h,v 1.1.2.2 2004/07/13 22:16:05 kowens Exp $ Copyright (c) 2004, Legato Systems, Inc.GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: nworabr.c,v 1.1.2.13 2005/03/02 19:30:43 kowens Exp $ Copyright (c) 2005, LEGATO Software, a division of EMC$Id: sbtpc_meta.h,v 1.1.2.2 2004/07/13 22:16:05 kowens Exp $ Copyright (c) 2004, Legato Systems, Inc.GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: nworaenv.c,v 1.1.2.4 2005/03/10 19:47:50 kowens Exp $ Copyright (c) 2005, LEGATO Software, a division of EMC$Id: sbtpc_meta.h,v 1.1.2.2 2004/07/13 22:16:05 kowens Exp $ Copyright (c) 2004, Legato Systems, Inc.GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: ora.c,v 1.1.2.2 2004/07/13 22:20:07 kowens Exp $ Copyright (c) 2004, Legato Systems, Inc.$Id: sbtpc_meta.h,v 1.1.2.2 2004/07/13 22:16:05 kowens Exp $ Copyright (c) 2004, Legato Systems, Inc.GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: remove.c,v 1.1.2.3 2004/08/11 19:25:51 kowens Exp $ Copyright (c) 2004, Legato Systems, Inc.$Id: sbtpc_meta.h,v 1.1.2.2 2004/07/13 22:16:05 kowens Exp $ Copyright (c) 2004, Legato Systems, Inc.GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: xdr_fid.c,v 1.1.2.2 2004/07/13 22:34:59 kowens Exp $ Copyright (c) 2004, Legato Systems, Inc.$Id: sbtpc_meta.h,v 1.1.2.2 2004/07/13 22:16:05 kowens Exp $ Copyright (c) 2004, Legato Systems, Inc.GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: nworapc.c,v 1.1.2.9 2005/03/22 12:51:58 kowens Exp $ Copyright (c) 2005, LEGATO Software, a division of EMC$Id: sbtpc_meta.h,v 1.1.2.2 2004/07/13 22:16:05 kowens Exp $ Copyright (c) 2004, Legato Systems, Inc.GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: sbtpc_obj.c,v 1.1.2.8 2005/03/22 12:52:21 kowens Exp $ Copyright (c) 2005, LEGATO Software, a division of EMC$Id: sbtpc_meta.h,v 1.1.2.2 2004/07/13 22:16:05 kowens Exp $ Copyright (c) 2004, Legato Systems, Inc.GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: pcobj_bak.c,v 1.1.2.7 2005/04/04 19:30:12 kowens Exp $ Copyright (c) 2005, LEGATO Software, a division of EMC$Id: sbtpc_meta.h,v 1.1.2.2 2004/07/13 22:16:05 kowens Exp $ Copyright (c) 2004, Legato Systems, Inc.GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: pcobj_res.c,v 1.1.2.8 2005/03/14 19:07:02 kowens Exp $ Copyright (c) 2005, LEGATO Software, a division of EMC$Id: sbtpc_meta.h,v 1.1.2.2 2004/07/13 22:16:05 kowens Exp $ Copyright (c) 2004, Legato Systems, Inc.GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: sbtinit.c,v 1.1.2.3 2004/10/12 18:55:49 kowens Exp $ Copyright (c) 2004, LEGATO Software, a division of EMC$Id: sbtpc_meta.h,v 1.1.2.2 2004/07/13 22:16:05 kowens Exp $ Copyright (c) 2004, Legato Systems, Inc.GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: sbt1.c,v 1.1.2.1 2004/07/13 18:42:57 kowens Exp $ Copyright (c) 2004, Legato Systems, Inc.GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: sbt2.c,v 1.1.2.9 2005/04/07 12:12:50 kowens Exp $ Copyright (c) 2005, Legato Systems, Inc.$Id: sbtpc_meta.h,v 1.1.2.2 2004/07/13 22:16:05 kowens Exp $ Copyright (c) 2004, Legato Systems, Inc.GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: sbtpc.c,v 1.1.2.9 2005/03/22 20:03:30 kowens Exp $ Copyright (c) 2005, Legato Systems, Inc.$Id: sbtpc_meta.h,v 1.1.2.2 2004/07/13 22:16:05 kowens Exp $ Copyright (c) 2004, Legato Systems, Inc.GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: signal.c,v 1.1.2.2 2004/07/14 22:12:44 kowens Exp $ Copyright (c) 2004, Legato Systems, Inc.$Id: sbtpc_meta.h,v 1.1.2.2 2004/07/13 22:16:05 kowens Exp $ Copyright (c) 2004, Legato Systems, Inc.GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: lnmbuf.c,v 1.1.2.3 2004/11/02 19:22:31 kowens Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: lnmerr.c,v 1.1.2.2 2005/02/01 11:36:52 kowens Exp $ Copyright (c) 2005, Legato Systems, Inc.GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: lnmidx.c,v 1.1.2.13 2005/01/28 15:15:36 kowens Exp $ Copyright (c) 2005, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: lnmstream.c,v 1.1.2.3 2005/03/02 16:48:50 kowens Exp $ Copyright (c) 2005, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: lnmutil.c,v 1.1.2.4 2004/10/26 20:38:43 kowens Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: logger.c,v 1.1.2.2 2005/01/24 15:30:34 kowens Exp $ Copyright (c) 2005, Legato Systems, Inc.GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: nwsess.c,v 1.1.2.8 2005/01/27 22:18:24 kowens Exp $ Copyright (c) 2005, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: dbgutil.c,v 1.1.2.4 2005/01/31 19:52:33 kowens Exp $ Copyright (c) 2005, Legato Systems, Inc.GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: fspaths.c,v 1.1.2.3 2004/10/12 18:50:16 kowens Exp $ Copyright (c) 2004, Legato Systems, Inc.GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: nworapcutil.c,v 1.1.2.5 2005/03/09 22:08:31 kowens Exp $ Copyright (c) 2005, Legato Systems, Inc.$Id: sbtpc_meta.h,v 1.1.2.2 2004/07/13 22:16:05 kowens Exp $ Copyright (c) 2004, Legato Systems, Inc.$Id: sbtpc_meta.h,v 1.1.2.2 2004/07/13 22:16:05 kowens Exp $ Copyright (c) 2004, Legato Systems, Inc.GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: nworares.c,v 1.1.2.3 2004/10/12 18:50:56 kowens Exp $ Copyright (c) 2004, Legato Systems, Inc.GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: sbtpc_meta.c,v 1.1.2.5 2004/10/12 18:52:15 kowens Exp $ Copyright (c) 2004, LEGATO Software, a division of EMC$Id: sbtpc_meta.h,v 1.1.2.2 2004/07/13 22:16:05 kowens Exp $ Copyright (c) 2004, Legato Systems, Inc.$Id: sbtpc_meta.h,v 1.1.2.2 2004/07/13 22:16:05 kowens Exp $ Copyright (c) 2004, Legato Systems, Inc.GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: util.c,v 1.1.2.7 2005/01/31 19:52:06 kowens Exp $ Copyright (c) 2005, Legato Systems, Inc.GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: whatinfo.c,v 1.1.2.1 2004/07/13 18:53:01 kowens Exp $ Copyright (c) 2004, Legato Systems, Inc.GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: pbagent.c,v 1.2 2004/06/06 00:42:57 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: lgpbpriv.c,v 1.1 2004/01/02 22:29:07 abakhshi Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: lgpbutil.c,v 1.3 2004/06/05 15:19:30 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: pb_attrlist.c,v 1.2 2004/01/31 23:23:21 blyon Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: db_rap.c,v 6.19 2003/10/18 22:28:51 pfagerst Exp $ Copyright 2003 Legato Systems Inc.GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: ssidpars.c,v 6.13 2003/10/18 22:31:11 pfagerst Exp $ Copyright (c) 2003, Legato Systems, Inc.GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: asdf.c,v 6.123 2004/06/06 00:50:48 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: asm_api.c,v 6.20 2003/11/19 18:41:58 caude Exp $ Copyright (c) 2003, Legato Systems, Inc.GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: asm_crc.c,v 1.20 2004/06/06 00:50:48 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: asm_save.c,v 6.186 2004/06/09 15:52:40 svarma Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: asm_subr.c,v 6.23 2003/10/18 21:58:39 pfagerst Exp $ Copyright (c) 2003, Legato Systems, Inc.GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: asmvarp.c,v 6.38 2004/06/06 00:50:48 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: builtin.c,v 6.48 2004/06/06 01:07:25 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: compress.c,v 6.17 2004/06/06 01:07:25 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: file_acl.c,v 6.28 2004/06/06 01:03:54 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: file_api.c,v 6.53 2004/06/18 19:53:48 nkryger Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: file_ca.c,v 6.45 2004/06/02 21:25:30 svarma Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: file_ext.c,v 6.8 2004/06/06 01:03:54 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: file_hfs.c,v 1.7 2004/06/06 01:03:54 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: file_hl.c,v 6.14 2004/06/06 01:03:54 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: file_hsm.c,v 6.19 2003/12/13 03:15:25 caude Exp $ Copyright (c) 2003, Legato Systems, Inc.GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: headasm.c,v 6.5 2004/06/06 01:07:25 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: holey.c,v 6.42 2004/06/06 01:07:25 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: legato_dxuldm.c,v 1.25 2004/06/17 19:38:55 preyes Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: logasm.c,v 6.6 2003/10/18 22:00:26 pfagerst Exp $ Copyright (c) 2003, Legato Systems, Inc.GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: mailasm.c,v 6.10 2003/10/18 22:00:30 pfagerst Exp $ Copyright (c) 2003, Legato Systems, Inc.GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: mbs_iface.c,v 6.9 2004/06/06 01:07:25 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: meta.c,v 6.47 2004/06/06 01:07:25 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: quota.c,v 6.20 2004/06/06 01:07:25 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: recov.c,v 6.97 2004/06/06 01:07:25 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: recov_ux.c,v 6.77 2004/06/06 01:07:25 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: rule.c,v 6.39 2003/12/16 17:49:14 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: save_ux.c,v 6.84 2004/06/06 01:03:36 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: stat_ux.c,v 6.20 2004/06/06 01:03:36 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: svrc.c,v 6.12 2003/10/18 22:01:59 pfagerst Exp $ Copyright (c) 2003, Legato Systems, Inc.GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: swapasm.c,v 6.30 2004/06/06 01:03:36 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: xlate.c,v 6.18 2004/06/06 01:07:25 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: access.c,v 6.15 2004/06/06 00:50:48 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: arch_ux.c,v 1.7 2003/10/18 22:03:14 pfagerst Exp $ Copyright (c) 2003, Legato Systems, IncorporatedGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: asm_dir.c,v 6.39 2004/06/06 00:50:48 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: asm_hlink.c,v 6.15 2004/06/06 00:50:48 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: asm_nsr.y,v 6.33 2004/06/18 19:53:48 nkryger Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: asm_raw.c,v 6.33 2004/06/06 00:50:48 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: bigasm.c,v 6.26 2004/06/06 01:07:25 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: dir_api.c,v 6.7 2004/06/06 01:07:25 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: extern.c,v 6.32 2004/06/06 01:07:25 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: inherit.c,v 6.8 2003/10/18 22:00:14 pfagerst Exp $ Copyright (c) 2003, Legato Systems, Inc.GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: interact.c,v 6.19 2004/06/06 01:07:25 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: asm_oracle.c,v 1.5 2004/06/06 00:50:48 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: amount.c,v 6.13 2004/06/06 00:33:38 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: asdf_io.c,v 6.41 2004/06/06 00:33:38 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: ca.c,v 6.8 2000/12/11 21:44:58 kan Exp $ Copyright (c) 2000, Legato Systems, Inc.GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: ca_impl.c,v 6.24 2004/06/06 00:33:46 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: ca_xdr.c,v 6.3 2004/06/06 00:33:46 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: hostslst.c,v 6.91 2004/06/10 17:15:04 blyon Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: id_subr.c,v 6.6 2003/10/18 21:22:35 pfagerst Exp $ Copyright (c) 2003, Legato Systems, Inc.GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: idx_path.c,v 6.42 2004/06/06 00:34:35 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: idx_util.c,v 6.41.6.1 2004/10/26 18:06:53 kowens Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: indx_xdr.c,v 6.19 2004/06/06 00:34:35 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: irecover.c,v 6.26 2004/06/10 17:15:04 blyon Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: is.c,v 6.41 2004/06/18 04:21:37 chejlava Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: isave.c,v 6.41 2004/06/06 00:34:35 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: localss.c,v 6.4 2004/06/06 00:36:31 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: m_iface.c,v 6.85 2004/06/06 00:45:22 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: mdb_subr.c,v 6.27 2004/06/06 00:45:22 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: mdb_trans.c,v 1.18 2004/06/06 00:45:22 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: mm_iface.c,v 6.82 2004/06/10 17:15:04 blyon Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: mm_ifce2.c,v 6.6 2003/10/18 21:25:05 pfagerst Exp $ Copyright (c) 2003, Legato Systems, Inc.GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: nde.c,v 6.13 2004/06/06 00:44:25 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: nsr_path.c,v 6.41 2004/06/06 00:44:25 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: nsr_res.c,v 6.4 2003/10/18 21:25:35 pfagerst Exp $ Copyright (c) 2003, Legato Systems, Inc.GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: nsr_str.c,v 6.5 2004/06/06 00:44:25 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: nsr_subr.c,v 6.97 2004/06/10 17:15:04 blyon Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: nsrattr.c,v 6.9 2004/06/06 00:44:25 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: nsrlib.c,v 6.14 2004/02/24 13:31:10 slattery Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: nsrport.c,v 6.38.22.1 2004/09/15 23:54:08 sbingham Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: nsrvarp.c,v 6.37 2004/06/18 22:09:26 mdrozd Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: rap.c,v 6.57 2004/06/06 00:45:32 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: rap_net.c,v 6.14 2003/10/18 21:26:34 pfagerst Exp $ Copyright (c) 2003, Legato Systems, Inc.GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: rlistxdr.c,v 6.16 2004/06/06 00:45:32 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: rm_misc.c,v 6.30 2004/06/06 00:45:32 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: rsi_xdr.c,v 6.4 2004/06/06 00:45:32 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: saveconn.c,v 6.39 2004/06/10 17:15:04 blyon Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: snooze.c,v 6.5 2003/10/18 21:27:31 pfagerst Exp $ Copyright (c) 2003, Legato Systems, Inc.GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: sr_util.c,v 6.51 2004/06/06 00:44:15 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: ssrc_xdr.c,v 6.9 2004/06/06 00:44:15 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: volop.c,v 6.26 2003/12/18 22:18:33 svarma Exp $ Copyright (c) 2003, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: xdr_fast.c,v 6.5 2004/06/06 00:45:32 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: xdr_glue.c,v 6.5 2003/10/18 21:28:02 pfagerst Exp $ Copyright (c) 2003, Legato Systems, Inc.GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: xplatutl.c,v 6.4 2003/10/18 21:28:06 pfagerst Exp $ Copyright (c) 2003, Legato Systems, Inc.GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: bsaattr.x,v 1.12 2004/06/05 23:58:30 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: bsrchutl.c,v 6.7 2004/06/06 00:45:32 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: dfrecover.c,v 6.2 2004/06/14 17:48:50 blyon Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: dfsave.c,v 6.1 2004/06/10 17:15:04 blyon Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: nsr_attr.c,v 6.37 2004/06/06 00:44:25 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: nsr_auth.c,v 6.39 2004/06/06 00:44:25 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: nsr_rpth.c,v 6.34 2003/11/17 22:48:48 btompkin Exp $ Copyright (c) 2003, Legato Systems, Inc.GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: rm_async.c,v 6.7 2003/10/18 21:26:48 pfagerst Exp $ Copyright (c) 2003, Legato Systems IncGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: clntglue.c,v 6.6 2003/10/18 21:21:32 pfagerst Exp $ Copyright (c) 2003, Legato Systems, Inc.GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: level.c,v 6.19 2004/06/06 00:36:31 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: attr.c,v 6.18 2003/10/18 20:48:23 pfagerst Exp $ Copyright (c) 2003, Legato Systems, Inc.GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: clnt.c,v 6.22 2003/10/18 20:48:31 pfagerst Exp $ Copyright (c) 2003, Legato Systems, Inc.GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: h_bool.c,v 6.8 2004/06/05 15:06:18 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: handlers.c,v 6.20 2004/06/17 15:05:10 gmcconne Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: info.c,v 6.35 2004/06/05 15:06:18 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: lgtoauth.c,v 6.47 2004/06/05 15:06:19 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: lgtocode.c,v 6.22 2004/06/05 15:06:19 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: parse.c,v 6.18 2004/06/05 15:06:19 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: rap_glob.c,v 6.24 2004/06/21 19:15:07 mdrozd Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: rap_misc.c,v 6.7 2004/06/05 15:06:19 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: rap_serv.c,v 6.46 2004/06/05 15:06:19 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: res.c,v 6.8 2003/10/18 20:50:03 pfagerst Exp $ Copyright (c) 2000 Legato Systems, Inc.GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: resdb.c,v 6.8 2004/04/07 21:31:54 svarma Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: resdbreg.c,v 6.5 2003/10/18 20:50:12 pfagerst Exp $ Copyright (c) 2002 Legato Systems, Inc.GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: resdir.c,v 6.17 2004/06/05 15:06:19 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: resfile.c,v 6.44 2003/10/18 20:50:22 pfagerst Exp $ Copyright (c) 2003, Legato Systems, Inc.GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: resid.c,v 6.15 2004/06/05 15:06:19 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: resnet.c,v 6.18 2003/10/18 20:50:35 pfagerst Exp $ Copyright (c) 2003, Legato Systems, Inc.GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: userlist.y,v 6.30 2004/06/05 15:06:19 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: hand.c,v 6.43 2004/06/21 19:15:07 mdrozd Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: author.c,v 6.14 2003/10/18 20:48:27 pfagerst Exp $ Copyright (c) 2003, Legato Systems, Inc.GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: a_gen.c,v 6.12 2003/11/27 01:42:17 killari Exp $ Copyright (c) 2003, Legato Systems, Inc.GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: a_lgto.c,v 6.20 2004/06/05 12:17:15 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: a_none.c,v 6.8 2004/06/05 12:17:15 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: a_unix.c,v 6.22 2004/06/05 12:17:15 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: c_gen.c,v 6.36 2003/12/16 21:41:01 btompkin Exp $ Copyright (c) 2003, Legato Systems, Inc.GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: c_perror.c,v 6.9.22.1 2005/02/04 23:57:13 wma Exp $ Copyright (c) 2005, Legato Systems, Inc.GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: c_tcp.c,v 6.52 2004/06/05 12:17:23 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: c_udp.c,v 6.22 2004/06/05 12:17:23 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: common.c,v 6.33 2004/06/05 12:17:23 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: p_getprt.c,v 6.22 2003/10/18 20:41:11 pfagerst Exp $ Copyright (c) 2003, Legato Systems, Inc.GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: p_prot.c,v 6.5 2004/06/05 12:23:36 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: p_rmt.c,v 6.42 2004/06/05 12:23:36 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: pmap.c,v 6.17 2003/12/15 19:27:15 blyon Exp $ Copyright (c) 2003, Legato Systems, Inc.GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: rpc_cmsg.c,v 6.8 2004/06/05 12:23:36 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: rpc_prot.c,v 6.9 2003/10/18 20:41:36 pfagerst Exp $ Copyright (c) 2003, Legato Systems, Inc.GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: rpcb.c,v 6.14 2003/10/18 20:41:41 pfagerst Exp $ Copyright (c) 2003, Legato Systems, Inc.GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: rpcport.c,v 6.33 2004/06/05 12:23:36 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: sreqclnt.c,v 6.27 2003/11/17 22:55:55 btompkin Exp $ Copyright (c) 2003, Legato Systems, Inc.GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: svc.c,v 6.49 2004/06/05 12:23:36 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: svc_auth.c,v 6.13 2003/11/27 01:42:17 killari Exp $ Copyright (c) 2003, Legato Systems, Inc.GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: svc_tcp.c,v 6.65 2004/06/05 12:23:36 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: svc_udp.c,v 6.27 2003/12/16 21:41:01 btompkin Exp $ Copyright (c) 2003, Legato Systems, Inc.GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: trap_xdr.c,v 6.5 2004/06/05 12:23:37 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: x_array.c,v 6.5 2004/06/05 12:23:37 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: x_count.c,v 6.9 2004/06/05 12:23:37 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: x_debug.c,v 6.22 2004/06/05 12:23:37 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: x_fixed.c,v 6.47 2004/06/05 12:23:37 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: x_mem.c,v 6.8 2004/06/05 12:23:37 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: x_rec.c,v 6.52 2004/06/05 12:23:37 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: x_ref.c,v 6.6 2004/06/05 12:23:37 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: x_stdio.c,v 6.6 2004/06/05 12:23:37 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: x_util.c,v 6.4 2004/06/05 12:23:37 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: xdr.c,v 6.40 2004/06/05 12:23:37 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: xdrcopy.c,v 6.20 2004/06/05 12:23:37 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: brsvport.c,v 6.20 2004/06/05 12:23:36 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: fdtable.c,v 6.5 2004/06/05 12:23:36 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: p_clnt.c,v 6.29 2003/10/18 20:41:02 pfagerst Exp $ Copyright (c) 2003, Legato Systems, Inc.GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: p_prot2.c,v 6.6 2004/06/05 12:23:36 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: rpcssn.c,v 6.3 2004/06/05 12:23:36 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: ssn_common.c,v 6.4 2004/06/12 02:34:14 killari Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: svc_algt.c,v 6.19 2004/06/05 12:14:28 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: svc_au.c,v 6.11 2004/06/05 12:23:36 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: msgssn.c,v 6.4 2004/06/05 12:23:36 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: addtoenv.c,v 6.8 2004/06/05 11:54:48 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: app_path.c,v 6.29 2004/06/05 11:54:48 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: attr.c,v 6.7 2004/06/05 11:54:48 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: attr_pri.c,v 6.6 2004/06/05 11:54:48 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: bknstdio.c,v 6.20 2004/06/05 11:54:48 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: bsearch.c,v 6.10 2004/06/05 11:54:48 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: canon.c,v 6.37 2004/06/18 19:53:47 nkryger Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: catgets.c,v 1.87 2004/06/07 20:56:37 mblaszcz Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: compress.c,v 6.13 2004/06/05 11:54:48 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: console.c,v 1.13 2004/06/05 11:54:48 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: crc.c,v 1.21 2004/06/05 11:54:48 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: cvcmprss.c,v 6.14 2004/06/05 11:54:48 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: dir.c,v 6.16 2004/06/18 04:20:42 chejlava Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: errinfo.c,v 1.29 2004/06/09 19:36:18 bbishop Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: execpath.c,v 6.25 2004/06/05 11:54:49 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: fmatch.c,v 6.14 2004/06/05 11:54:49 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: fsent.c,v 6.88.6.1 2005/01/12 19:08:18 kowens Exp $ Copyright (c) 2005, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: fullp_ux.c,v 6.22 2004/06/05 11:54:49 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: get_myad.c,v 6.27 2004/06/05 11:54:49 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: getdate.y,v 6.25 2004/06/03 17:49:29 jquintei Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: gtdtblsz.c,v 6.10 2004/06/05 11:54:49 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: hashstr.c,v 6.7 2004/06/05 11:54:49 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: is_mynam.c,v 1.39 2004/06/05 11:54:49 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: lcase.c,v 6.9 2004/06/05 11:54:49 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: lctime.c,v 6.37 2004/06/05 11:54:49 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: lg_lckfl.c,v 6.15 2004/06/05 11:54:49 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: lg_sys64.c,v 6.57 2004/06/17 19:53:42 mblaszcz Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: lg_time.c,v 6.9 2004/06/05 11:54:50 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: lg_unlink.c,v 6.11 2004/06/05 11:54:50 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: lg_utl64.c,v 6.32 2004/06/05 11:54:50 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: lgblock.c,v 6.4 2004/06/05 11:54:50 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: lgclus.c,v 1.58 2004/06/05 11:54:50 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: lgclus_lc.c,v 6.56 2004/06/05 11:54:50 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: lgclus_solaris.c,v 6.13 2004/06/05 11:54:50 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: lgdomain.c,v 6.10 2004/06/05 11:54:50 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: lggetenv.c,v 6.11 2004/06/05 11:54:50 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: lginit.c,v 1.72 2004/06/17 19:53:29 mblaszcz Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: lgprint.c,v 6.100 2004/06/05 11:54:50 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: lgreaddir.c,v 6.5 2004/06/05 11:54:50 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: lgselect.c,v 6.16 2004/06/05 11:54:50 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: lgthread.c,v 6.30 2004/06/05 11:54:50 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: liblvarp.c,v 6.39 2004/06/05 11:54:50 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: liblvars.c,v 6.13 2004/06/05 11:54:50 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: list.c,v 6.15 2004/06/05 11:54:50 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: localhst.c,v 6.12 2004/06/05 11:54:50 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: mntent.c,v 6.28 2004/06/05 11:54:51 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: mtsfuncs.c,v 6.21 2004/06/05 11:54:51 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: myname.c,v 6.19 2004/06/05 11:54:51 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: origin.c,v 6.24 2004/06/05 11:54:51 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: preflen.c,v 6.8 2004/06/05 11:54:51 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: print.c,v 6.40.6.2 2004/11/16 22:44:00 parmorer Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: qsort.c,v 6.7 2004/06/05 11:54:51 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: random.c,v 6.11 2004/06/05 11:54:51 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: regevent.c,v 6.21 2004/06/05 11:54:51 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: setreuid.c,v 6.22 2004/06/05 11:54:51 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: sha_func.c,v 6.9 2004/06/05 11:54:51 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: shmem.c,v 6.60 2004/06/05 11:54:51 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: shrttime.c,v 6.27 2004/06/05 11:54:51 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: spawn.c,v 6.102 2004/06/18 19:53:47 nkryger Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: strerror.c,v 6.16 2004/06/05 11:54:51 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: strmanip.c,v 1.8 2004/06/05 11:54:51 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: strstr.c,v 6.17 2004/06/05 11:54:51 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: strvcat.c,v 6.7 2004/06/05 11:54:51 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: sysdesc.c,v 6.53 2004/06/05 11:54:51 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: timeval.c,v 6.6 2004/06/05 11:54:51 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 GCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: tokenize.c,v 6.20 2004/06/05 11:54:51 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: uicreate.c,v 6.36 2004/06/05 11:54:52 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: unc_path.c,v 6.15 2004/06/05 11:54:52 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: usergrp.c,v 6.23 2004/06/05 11:54:52 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: utf8.c,v 1.140.6.2 2004/07/28 22:44:32 rbrown Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: val.c,v 6.5.6.2 2004/08/04 20:24:53 parmorer Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: valstr.c,v 6.5 2004/06/05 11:54:52 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: varp.c,v 6.40 2004/06/01 00:50:48 wmaruyam Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: xmalloc.c,v 6.17 2004/06/18 04:20:50 chejlava Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: closefil.c,v 6.16 2004/06/05 11:54:48 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: dbgsignl.c,v 6.11 2004/06/05 11:54:48 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: debug.c,v 1.10 2004/06/05 11:54:48 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: getprocs.c,v 6.17 2004/06/05 11:54:49 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: installdir.c,v 6.10 2004/06/05 11:54:49 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: lgpurify.c,v 6.8 2004/06/05 11:54:50 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: locatcor.c,v 6.24 2004/06/05 11:54:50 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: regexp.c,v 6.16 2004/06/05 11:54:51 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: WorkShop Compilers 5.0 98/12/21 $Id: dirname.c,v 6.7 2004/06/05 11:54:49 btompkin Exp $ Copyright (c) 2004, LEGATO Software, a division of EMCGCC: (GNU) 3.3as: Sun WorkShop 6 99/08/18 GCC: (GNU) 3.2.3as: Sun WorkShop 6 99/08/18 GCC: (GNU) 3.2.3ld: Software Generation Utilities - Solaris Link Editors: 5.7-1.280.hash.dynsym.dynstr.SUNW_version.rela.got.rela.data.rel.local.rela.data.rel.rela.plt.text.rodata.dynamic.data.bss.symtab.strtab.debug_abbrev.debug_info.debug_line.debug_frame.debug_pubnames.debug_aranges.debug_str.comment.debug_ranges.shstrtabh ii:"oww%BxHxHP /Bnn0DB@@SB88X ]ʐʐ cxxX*$xX%AA k%``4%bbt%y(y( I%z%ƨ T